Products > Catalog Proteins > Cytokines & Cytokine receptors

Recombinant Human IL-36 beta Protein (RP00020)

Datasheet

Overview

Product nameRecombinant Human IL-36 beta Protein
Catalog No.RP00020
DescriptionRecombinant Human IL-36 beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg5-Glu157) of human IL-36 beta (Accession #NP_775270.1) fused with a 6×His tag at the C-terminus.
Swiss portQ9NZH7
Gene ID27177
SpeciesHuman
AA Sequence REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Interleukin-1 family member 8(IL1F8) also known as IL36B, is a member of the interleukin 1(IL-1) cytokine family. IL-36 beta is expressed by keratinocytes, naïve CD4+ T cells, neurons, and glia. It is up-regulated in keratinocytes and synovial fibroblasts by inflammatory stimulation and in psoriatic lesions. IL-36 beta promotes inflammatory responses by enhancing the activation and Th1 polarization of dendritic cells and T cells. It also enhances the production of multiple pro-inflammatory cytokines, chemokines, and anti-bacterial defensin peptides by keratinocytes, synovial fibroblasts, and articular chondrocytes. IL-1 family members exert their effects through binding to receptors that belong to the IL-1 receptor (IL-1R) family.
SynonymFIL1; FIL1-(ETA); FIL1H; FILI-(ETA); IL-1F8; IL-1H2; IL1-ETA; IL1F8; IL1H2
Expressed HostE. coli
Tag6×His tag at the C-terminus
Purity> 92% by SDS-PAGE.
Endotoxin< 0.1 EU/μg of the protein by LAL method.
FormulationLyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
StorageStore the lyophilized protein at -20°C to -80 °C for long term. |After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
ReconstitutionReconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.

Inquire About This Product

Submit your question about RP00020 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Select size and quantity
Contact us to order