Publications (7) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human
Product name | von Willebrand factor (VWF) Rabbit pAb |
---|---|
Catalog No. | A1335 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 2645-2813 of human von Willebrand factor (VWF) (NP_000543.2). |
---|---|
Sequence | LPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK |
Gene ID | 7450 |
Swiss prot | P04275 |
Synonyms | VWD; F8VWF; von Willebrand factor (VWF) |
Calculated MW | 309kDa |
Observed MW | 309kDa |
Reactivity | Human |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | ECV-304 |
Cellular location | Secreted, extracellular matrix, extracellular space |
Customer validation | ICC (Rattus norvegicus) WB (Homo sapiens, Mus musculus) IHC (Homo sapiens, Rattus norvegicus) IF (Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A1335 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on VWF. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to VWF. (Distance between topics and target gene indicate popularity.) VWF
* Data provided by citexs.com, for reference only.
Publishing research using A1335? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.