Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

p53 Rabbit pAb (A5761)

Reviews (3) Publications (25) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Immunoprecipitation - p53 Rabbit pAb (A5761)

Immunoprecipitation analysis of 200 μg extracts of U-251MG cells using 3 μg p53 antibody (A5761). Western blot was performed from the immunoprecipitate using p53 antibody (A5761) at a dilution of 1:1000.

ABclonal:Immunoprecipitation - p53 Rabbit pAb (A5761)

Immunoprecipitation analysis of 200 μg extracts of U-251MG cells using 3 μg p53 antibody (A5761). Western blot was performed from the immunoprecipitate using p53 antibody (A5761) at a dilution of 1:1000.

Review
ABclonal: review for p53 Rabbit pAb(A5761)
Review
ABclonal: review for p53 Rabbit pAb(A5761)
Review
ABclonal: review for p53 Rabbit pAb(A5761)

You may also interested in:

Overview

Product name p53 Rabbit pAb
Catalog No. A5761
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277).

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 218-390 of human p53 (NP_035770.2).
Sequence EPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
Gene ID 7157
Swiss prot P04637
Synonyms P53; BCC7; LFS1; BMFS5; TRP53; p53
Calculated MW 44kDa
Observed MW 53kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:3000 - 1:6000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples U-251MG
Cellular location Cytoplasm, Endoplasmic reticulum, Mitochondrion matrix, Nucleus, PML body
Customer validation

WB (Hepatoma cell line, Rat cells, MEFHomo sapiens, Homo sapiens, Rattus norvegicus, Lampetra japonica, Mus musculus, Sus scrofa, ovis aries)

IF (Lampetra japonica, Mus musculus)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

p53 Rabbit pAb images

ABclonal:Immunoprecipitation - p53 Rabbit pAb (A5761)}

Immunoprecipitation - p53 Rabbit pAb (A5761)

Immunoprecipitation analysis of 200 μg extracts of U-251MG cells using 3 μg p53 antibody (A5761). Western blot was performed from the immunoprecipitate using p53 antibody (A5761) at a dilution of 1:1000.
ABclonal:Immunoprecipitation - p53 Rabbit pAb (A5761)}

Immunoprecipitation - p53 Rabbit pAb (A5761)

Immunoprecipitation analysis of 200 μg extracts of U-251MG cells using 3 μg p53 antibody (A5761). Western blot was performed from the immunoprecipitate using p53 antibody (A5761) at a dilution of 1:1000.

Submit an review for A5761

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5761 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TP53. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TP53. (Distance between topics and target gene indicate popularity.) TP53

* Data provided by citexs.com, for reference only.

Publishing research using A5761? Please let us know so that we can cite the reference in this datasheet.

Antibodies (31)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order