Reviews (2)Publications (21) Datasheet
Western blot analysis of extracts of 293T cells, using p53 Rabbit pAb (A0263) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry of paraffin-embedded human colon carcinoma using p53 Rabbit pAb (A0263) at dilution of 1:150 (40x lens).
Confocal immunofluorescence analysis of Hela cells using p53 Polyclonal Antibody (A0263) at dilution of 1:200. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of U-2 OS cells using p53 Polyclonal Antibody (A0263) at dilution of 1:200. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200ug extracts of 293T cells using 3ug HK1 antibody (A0263). Western blot was performed from the immunoprecipitate using HK1 (A0263) at a dilition of 1:3000.
Chromatin immunoprecipitation analysis of extracts of 293T cells, using p53 antibody (A0263) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
| Product name | p53 Rabbit pAb |
|---|---|
| Catalog No. | A0263 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human p53 (NP_000537.3). |
|---|---|
| Sequence | MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFR |
| Gene ID | 7157 |
| Swiss prot | P04637 |
| Synonyms | BCC7; LFS1; P53; TRP53; p53; TP53; BMFS5 |
| Calculated MW | 23-43kDa |
| Observed MW | 53KDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
| Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 ChIP 1:50 - 1:100 IP 1:50 - 1:200 |
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | 293T |
| Cellular location | Cytoplasm, Endoplasmic reticulum, Mitochondrion matrix, Nucleus, PML body |
| Customer validation | (Human cells, SW480) WB(Homo sapiens, Mus musculus, Gallus gallus, Danio rerio, Rattus norvegicus) IHC(Mus musculus) IHC(Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A0263 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A0263? Please let us know so that we can cite the reference in this datasheet.
