Reviews (2)Publications (20) Datasheet
Product name | p53 Rabbit pAb |
---|---|
Catalog No. | A0263 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human p53 (NP_000537.3). |
---|---|
Sequence | MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFR |
Gene ID | 7157 |
Swiss prot | P04637 |
Synonyms | BCC7; LFS1; P53; TRP53; p53; TP53; BMFS5 |
Calculated MW | 23-43kDa |
Observed MW | 53KDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 ChIP 1:50 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293T |
Cellular location | Cytoplasm, Endoplasmic reticulum, Mitochondrion matrix, Nucleus, PML body |
Customer validation | (Human cells, SW480) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus, Danio rerio) IHC(Rattus norvegicus) IHC(Mus musculus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at [email protected]
Submit your question about A0263 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A0263? Please let us know so that we can cite the reference in this datasheet.