Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | [One Step]NDUFV2 Antibody Kit |
---|---|
Catalog No. | RK05672 |
Component | Name | Recommended Dilution | Applications | Species Reactivity |
---|---|---|---|---|
Primary Antibody | [KO Validated] NDUFV2 Rabbit pAb | 1:1000 dilution | WB | Human, Mouse, Rat |
Secondary Antibody | HRP Goat Anti-Rabbit IgG (H+L) | 1:4000 dilution |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-249 of human NDUFV2 (NP_066552.2). |
---|---|
Sequence | MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL |
Gene ID | 4729 |
Swiss prot | P19404 |
Synonyms | NDUFV2; CI-24k |
Calculated MW | 27kDa |
---|---|
Observed MW | 27kDa |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Cellular location | Mitochondrion inner membrane |
Submit your question about RK05672 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
* For research use only. Not for therapeutic or diagnostic purposes.