Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

mTOR Rabbit pAb (A11355)

Reviews (3) Publications (9) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - mTOR Rabbit pAb (A11355)

Western blot analysis of various lysates using mTOR Rabbit pAb (A11355) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - mTOR Rabbit pAb (A11355)

Immunofluorescence analysis of NIH-3T3 cells using mTOR Rabbit pAb (A11355) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - mTOR Rabbit pAb (A11355)

Immunofluorescence analysis of U-2 OS cells using mTOR Rabbit pAb (A11355) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - mTOR Rabbit pAb (A11355)

Immunoprecipitation analysis of 300ug extracts of K-562 cells using 3ug mTOR Rabbit pAb (A11355 1:50). Western blot was performed from the immunoprecipitate using mTOR Rabbit pAb (A2445) at a dilition of 1:500.

Review
ABclonal: review for mTOR Rabbit pAb(A11355)
Review
ABclonal: review for mTOR Rabbit pAb(A11355)
Review
ABclonal: review for mTOR Rabbit pAb(A11355)

You may also interested in:

Overview

Product name mTOR Rabbit pAb
Catalog No. A11355
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This kinase is a component of two distinct complexes, mTORC1, which controls protein synthesis, cell growth and proliferation, and mTORC2, which is a regulator of the actin cytoskeleton, and promotes cell survival and cell cycle progression. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. Inhibitors of mTOR are used in organ transplants as immunosuppressants, and are being evaluated for their therapeutic potential in SARS-CoV-2 infections. Mutations in this gene are associated with Smith-Kingsmore syndrome and somatic focal cortical dysplasia type II. The ANGPTL7 gene is located in an intron of this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human mTOR (NP_004949.1).
Sequence CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQI
Gene ID 2475
Swiss prot P42345
Synonyms SKS; FRAP; FRAP1; FRAP2; RAFT1; RAPT1; mTOR
Calculated MW 289kDa
Observed MW 289kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, HepG2, K-562
Cellular location Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Golgi apparatus membrane, Lysosome, Mitochondrion outer membrane, Nucleus, PML body, Peripheral membrane protein
Customer validation

IF (HeLa cells)

WB (Human chronic myeloid leukemia cellsHomo sapiens, Rattus norvegicus, Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

mTOR Rabbit pAb images

ABclonal:Western blot - mTOR Rabbit pAb (A11355)}

Western blot - mTOR Rabbit pAb (A11355)

Western blot analysis of various lysates using mTOR Rabbit pAb (A11355) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - mTOR Rabbit pAb (A11355)}

Immunofluorescence - mTOR Rabbit pAb (A11355)

Immunofluorescence analysis of NIH-3T3 cells using mTOR Rabbit pAb (A11355) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - mTOR Rabbit pAb (A11355)}

Immunofluorescence - mTOR Rabbit pAb (A11355)

Immunofluorescence analysis of U-2 OS cells using mTOR Rabbit pAb (A11355) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - mTOR Rabbit pAb (A11355)}

Immunoprecipitation - mTOR Rabbit pAb (A11355)

Immunoprecipitation analysis of 300ug extracts of K-562 cells using 3ug mTOR Rabbit pAb (A11355 1:50). Western blot was performed from the immunoprecipitate using mTOR Rabbit pAb (A2445) at a dilition of 1:500.

Submit an review for A11355

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A11355 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MTOR. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MTOR. (Distance between topics and target gene indicate popularity.) MTOR

* Data provided by citexs.com, for reference only.

Publishing research using A11355? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order