Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

eIF4E Rabbit mAb (A19044)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - eIF4E Rabbit mAb (A19044)

Western blot analysis of various lysates using eIF4E Rabbit mAb (A19044) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunoprecipitation - eIF4E Rabbit mAb (A19044)

Immunoprecipitation analysis of 600 μg extracts of Mouse testis using 3 μg eIF4E antibody (A19044). Western blot was performed from the immunoprecipitate using eIF4E (A19044) at a dilution of 1:500.

You may also interested in:

Overview

Product name eIF4E Rabbit mAb
Catalog No. A19044
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0447

Background

The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 118-217 of human eIF4E (P06730).
Sequence NKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
Gene ID 1977
Swiss prot P06730
Synonyms CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1; eIF4E
Calculated MW 25kDa
Observed MW 25kDa

Applications

Reactivity Mouse, Rat
Tested applications Testing results
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples Mouse testis, Mouse liver, Rat testis
Cellular location Cytoplasm, P-body
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

eIF4E Rabbit mAb images

ABclonal:Western blot - eIF4E Rabbit mAb (A19044)}

Western blot - eIF4E Rabbit mAb (A19044)

Western blot analysis of various lysates using eIF4E Rabbit mAb (A19044) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
ABclonal:Immunoprecipitation - eIF4E Rabbit mAb (A19044)}

Immunoprecipitation - eIF4E Rabbit mAb (A19044)

Immunoprecipitation analysis of 600 μg extracts of Mouse testis using 3 μg eIF4E antibody (A19044). Western blot was performed from the immunoprecipitate using eIF4E (A19044) at a dilution of 1:500.

Inquire About This Product

Submit your question about A19044 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EIF4E. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EIF4E. (Distance between topics and target gene indicate popularity.) EIF4E

* Data provided by citexs.com, for reference only.

Publishing research using A19044? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order