Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

eIF4EBP1 Rabbit mAb (A19045)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - eIF4EBP1 Rabbit mAb (A19045)

Western blot analysis of various lysates using eIF4EBP1 Rabbit mAb (A19045) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - eIF4EBP1 Rabbit mAb (A19045)

Immunohistochemistry analysis of eIF4EBP1 in paraffin-embedded human lung cancer using eIF4EBP1 Rabbit mAb (A19045) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name eIF4EBP1 Rabbit mAb
Catalog No. A19045
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0374

Background

This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4EBP1 (Q13541).
Sequence MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRN
Gene ID 1978
Swiss prot Q13541
Synonyms BP-1; 4EBP1; 4E-BP1; PHAS-I; eIF4EBP1
Calculated MW 13kDa
Observed MW 18kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples U-251MG, Rat skeletal muscle
Cellular location cytoplasm, cytosol
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

eIF4EBP1 Rabbit mAb images

ABclonal:Western blot - eIF4EBP1 Rabbit mAb (A19045)}

Western blot - eIF4EBP1 Rabbit mAb (A19045)

Western blot analysis of various lysates using eIF4EBP1 Rabbit mAb (A19045) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - eIF4EBP1 Rabbit mAb (A19045)}

Immunohistochemistry - eIF4EBP1 Rabbit mAb (A19045)

Immunohistochemistry analysis of eIF4EBP1 in paraffin-embedded human lung cancer using eIF4EBP1 Rabbit mAb (A19045) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19045 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EIF4EBP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EIF4EBP1. (Distance between topics and target gene indicate popularity.) EIF4EBP1

* Data provided by citexs.com, for reference only.

Publishing research using A19045? Please let us know so that we can cite the reference in this datasheet.

Antibodies (15)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order