Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

eEF1A1 Rabbit mAb (A11545)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - eEF1A1 Rabbit mAb (A11545)

Western blot analysis of various lysates using eEF1A1 Rabbit mAb (A11545) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - eEF1A1 Rabbit mAb (A11545)

Confocal imaging of C6 cells using eEF1A1 Rabbit mAb (A11545, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

You may also interested in:

Overview

Product name eEF1A1 Rabbit mAb
Catalog No. A11545
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0626

Background

This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human eEF1A1 (NP_001393.1).
Sequence LQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP
Gene ID 1915
Swiss prot P68104
Synonyms CCS3; EF1A; PTI1; CCS-3; EE1A1; EEF-1; EEF1A; EF-Tu; EF1A1; LENG7; eEF1A-1; GRAF-1EF; EF1alpha1; eEF1A1
Calculated MW 50kDa
Observed MW 50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, 293T, MCF7, Mouse lung, Mouse liver, Mouse kidney, Rat kidney
Cellular location Cytoplasm, Nucleus, nucleolus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

eEF1A1 Rabbit mAb images

ABclonal:Western blot - eEF1A1 Rabbit mAb (A11545)}

Western blot - eEF1A1 Rabbit mAb (A11545)

Western blot analysis of various lysates using eEF1A1 Rabbit mAb (A11545) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - eEF1A1 Rabbit mAb (A11545)}

Immunofluorescence - eEF1A1 Rabbit mAb (A11545)

Confocal imaging of C6 cells using eEF1A1 Rabbit mAb (A11545, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Inquire About This Product

Submit your question about A11545 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EEF1A1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EEF1A1. (Distance between topics and target gene indicate popularity.) EEF1A1

* Data provided by citexs.com, for reference only.

Publishing research using A11545? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order