Reviews (2)Publications (19) Datasheet
Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | [KO Validated] c-Myc Rabbit pAb |
---|---|
Catalog No. | A1309 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 347-439 of human c-Myc (NP_002458.2). |
---|---|
Sequence | VLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRR |
Gene ID | 4609 |
Swiss prot | P01106 |
Synonyms | MRTL; MYCC; bHLHe39; c-Myc; MYC |
Calculated MW | 48kDa/50kDa |
Observed MW | 60KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution | WB 1:500 - 1:2000 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | HCT116, MCF7, NIH/3T3, Mouse liver |
Cellular location | Nucleus, nucleolus, nucleoplasm |
Customer validation | (unknow, Human Bladder Cancer) WB(Homo sapiens, Gallus gallus, Mus musculus, Sus scrofa) Co-IP(Homo sapiens,Gallus gallus, Homo sapiens, Mus musculus) ChIP(Homo sapiens,Mus musculus) IP(Homo sapiens,Mus musculus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A1309 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A1309? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.