Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)

Publications (34) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)

Western blot analysis of lysates from Mouse heart, using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)

Western blot analysis of various lysates, using Smooth Muscle Actin(SMA) Rabbit pAb (A7248) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)

Immunofluorescence analysis of paraffin-embedded Human colon CA using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)

Immunofluorescence analysis of paraffin-embedded mouse large intestine using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name α-Smooth Muscle Actin (ACTA2) Rabbit pAb
Catalog No. A7248
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human α-Smooth Muscle Actin (ACTA2) (NP_001604.1).
Sequence MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAP
Gene ID 59
Swiss prot P62736
Synonyms ACTSA; α-Smooth Muscle Actin (ACTA2)
Calculated MW 42kDa
Observed MW 42kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:20 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse heart
Cellular location Cytoplasm, cytoskeleton
Customer validation

WB (Mus musculus, Homo sapiens, Zea mays, Rattus norvegicus)

IF (Mus musculus, Rattus norvegicus, Homo sapiens)

IHC (Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

α-Smooth Muscle Actin (ACTA2) Rabbit pAb images

ABclonal:Western blot - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)}

Western blot - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)

Western blot analysis of lysates from Mouse heart, using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)}

Western blot - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)

Western blot analysis of various lysates, using Smooth Muscle Actin(SMA) Rabbit pAb (A7248) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)}

Immunofluorescence - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)

Immunofluorescence analysis of paraffin-embedded Human colon CA using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)}

Immunofluorescence - α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248)

Immunofluorescence analysis of paraffin-embedded mouse large intestine using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7248 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ACTA2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ACTA2. (Distance between topics and target gene indicate popularity.) ACTA2

* Data provided by citexs.com, for reference only.

Publishing research using A7248? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order