Tested applications:WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | Alpha-tubulin (ubiquitous) chain Rabbit pAb |
---|---|
Catalog No. | AC024 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence within amino acids 1-80 of human Alpha-tubulin (ubiquitous) chain (NP_006073.2). |
---|---|
Sequence | MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRT |
Gene ID | 10376 |
Swiss prot | P68363 |
Synonyms | TUBA1B; K-ALPHA-1 |
Calculated MW | 37kDa/50kDa |
Observed MW | 52kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. May contain BSA. If BSA-free batch required, please contact us. |
Application key | Western blotting Immunohistochemistry |
Positive samples | HeLa, PC-12, A-549, U-251MG, Mouse brain |
Cellular location | Cytoplasm, cytoskeleton |
Submit your question about AC024 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on TUBA1B. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to TUBA1B. (Distance between topics and target gene indicate popularity.) TUBA1B
* Data provided by citexs.com, for reference only.
Publishing research using AC024? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.