Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZSCAN4 Rabbit pAb (A12015)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - ZSCAN4 Rabbit pAb (A12015)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with ZSCAN4, using ZSCAN4 Rabbit pAb (A12015) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name ZSCAN4 Rabbit pAb
Catalog No. A12015
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The ZSCAN4 gene encodes a protein involved in telomere maintenance and with a key role in the critical feature of mouse embryonic stem (ES) cells, namely, defying cellular senescence and maintaining normal karyotype for many cell divisions in culture (Zalzman et al., 2010 [PubMed 20336070]).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human ZSCAN4 (NP_689890.1).
Sequence MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFHSWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQEALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENITNQGNQIVSLIIIQEENG
Gene ID 201516
Swiss prot Q8NAM6
Synonyms ZNF494; ZSCAN4
Calculated MW 49kDa
Observed MW 57kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T transfected with ZSCAN4
Cellular location Chromosome, Nucleus, telomere
Customer validation

WB (Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ZSCAN4 Rabbit pAb images

ABclonal:Western blot - ZSCAN4 Rabbit pAb (A12015)}

Western blot - ZSCAN4 Rabbit pAb (A12015)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with ZSCAN4, using ZSCAN4 Rabbit pAb (A12015) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A12015 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZSCAN4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZSCAN4. (Distance between topics and target gene indicate popularity.) ZSCAN4

* Data provided by citexs.com, for reference only.

Publishing research using A12015? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order