Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZSCAN1 Rabbit pAb (A16639)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - ZSCAN1 Rabbit pAb (A16639)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with ZSCAN1 using ZSCAN1 Rabbit pAb (A16639) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Western blot - ZSCAN1 Rabbit pAb (A16639)

Western blot analysis of lysates from T-47D cells, using ZSCAN1 Rabbit pAb (A16639) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

You may also interested in:

Overview

Product name ZSCAN1 Rabbit pAb
Catalog No. A16639
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of chromatin.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ZSCAN1 (NP_872378.3).
Sequence VFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQK
Gene ID 284312
Swiss prot Q8NBB4
Synonyms MZF-1; ZNF915; ZSCAN1
Calculated MW 45kDa
Observed MW 45kDa/62kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T transfected with ZSCAN1, T-47D
Cellular location nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ZSCAN1 Rabbit pAb images

ABclonal:Western blot - ZSCAN1 Rabbit pAb (A16639)}

Western blot - ZSCAN1 Rabbit pAb (A16639)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with ZSCAN1 using ZSCAN1 Rabbit pAb (A16639) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Western blot - ZSCAN1 Rabbit pAb (A16639)}

Western blot - ZSCAN1 Rabbit pAb (A16639)

Western blot analysis of lysates from T-47D cells, using ZSCAN1 Rabbit pAb (A16639) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Inquire About This Product

Submit your question about A16639 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZSCAN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZSCAN1. (Distance between topics and target gene indicate popularity.) ZSCAN1

* Data provided by citexs.com, for reference only.

Publishing research using A16639? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order