Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZNF763 Rabbit pAb (A16615)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - ZNF763 Rabbit pAb (A16615)

Western blot analysis of various lysates using ZNF763 Rabbit pAb (A16615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

ABclonal:Western blot - ZNF763 Rabbit pAb (A16615)

Western blot analysis of various lysates using ZNF763 Rabbit pAb (A16615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

You may also interested in:

Overview

Product name ZNF763 Rabbit pAb
Catalog No. A16615
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable DNA-binding transcription factor activity and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 315-370 of human ZNF763 (NP_001012771.1).
Sequence CECSKCNKAFRSYRSYLRHKRSHTGEKPYQCKECRKAFTYPSSLRRHERTHSAKKP
Gene ID 284390
Swiss prot Q0D2J5
Synonyms ZNF; ZNF440L; ZNF763
Calculated MW 46kDa
Observed MW 46kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, Mouse liver
Cellular location Nucleus

Research Area

ZNF763 Rabbit pAb images

ABclonal:Western blot - ZNF763 Rabbit pAb (A16615)}

Western blot - ZNF763 Rabbit pAb (A16615)

Western blot analysis of various lysates using ZNF763 Rabbit pAb (A16615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.
ABclonal:Western blot - ZNF763 Rabbit pAb (A16615)}

Western blot - ZNF763 Rabbit pAb (A16615)

Western blot analysis of various lysates using ZNF763 Rabbit pAb (A16615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Inquire About This Product

Submit your question about A16615 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZNF763. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZNF763. (Distance between topics and target gene indicate popularity.) ZNF763

* Data provided by citexs.com, for reference only.

Publishing research using A16615? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order