Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZNF521 Rabbit pAb (A20646)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - ZNF521 Rabbit pAb (A20646)

Western blot analysis of lysates from Rat brain, using ZNF521 Rabbit pAb (A20646) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name ZNF521 Rabbit pAb
Catalog No. A20646
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables protein domain specific binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within neuron fate commitment. Located in nucleus.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-420 of human ZNF521 (NP_056276.1).
Sequence GFLSSSSLHGHMQVHERNKDGSQSGSRMEDWKMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRAALQCVYCHELFVEETSLMNHMEQVHSGEKKNSCSICSESFHTVEELYSHMDSHQQPESCNHSNSPSLVTVGYTSVSSTTPDSNLSVDSSTMVEAAPPIPKSRGRKRAAQQTPDMTGPSSKQAKVTYSCIYCNKQLFSSLAV
Gene ID 25925
Swiss prot Q96K83
Synonyms EHZF; Evi3; ZNF521
Calculated MW 148kDa
Observed MW 148kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Rat brain
Cellular location nucleoplasm, nucleus

Research Area

ZNF521 Rabbit pAb images

ABclonal:Western blot - ZNF521 Rabbit pAb (A20646)}

Western blot - ZNF521 Rabbit pAb (A20646)

Western blot analysis of lysates from Rat brain, using ZNF521 Rabbit pAb (A20646) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A20646 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZNF521. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZNF521. (Distance between topics and target gene indicate popularity.) ZNF521

* Data provided by citexs.com, for reference only.

Publishing research using A20646? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order