Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZGPAT Rabbit pAb (A16583)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - ZGPAT Rabbit pAb (A16583)

Western blot analysis of Mouse spleen, using ZGPAT antibody (A16583) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name ZGPAT Rabbit pAb
Catalog No. A16583
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in negative regulation of epidermal growth factor-activated receptor activity and negative regulation of transcription by RNA polymerase II. Located in nucleoplasm and plasma membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 213-272 of human ZGPAT (NP_115916.3).
Sequence PDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPPLRTE
Gene ID 84619
Swiss prot Q8N5A5
Synonyms ZIP; ZC3H9; GPATC6; GPATCH6; ZC3HDC9; KIAA1847; ZGPAT
Calculated MW 57kDa
Observed MW 57kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse spleen
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ZGPAT Rabbit pAb images

ABclonal:Western blot - ZGPAT Rabbit pAb (A16583)}

Western blot - ZGPAT Rabbit pAb (A16583)

Western blot analysis of Mouse spleen, using ZGPAT antibody (A16583) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A16583 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZGPAT. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZGPAT. (Distance between topics and target gene indicate popularity.) ZGPAT

* Data provided by citexs.com, for reference only.

Publishing research using A16583? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order