Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human
Product name | ZFYVE1 Rabbit pAb |
---|---|
Catalog No. | A7527 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-735 of human ZFYVE1 (NP_067083.1). |
---|---|
Sequence | AKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIVHVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILHCHNCRKEFSIKLSKH |
Gene ID | 53349 |
Swiss prot | Q9HBF4 |
Synonyms | SR3; DFCP1; TAFF1; ZNFN2A1; PPP1R172; ZFYVE1 |
Calculated MW | 87kDa |
Observed MW | 87kDa |
Reactivity | Human |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | 293T |
Cellular location | Endoplasmic reticulum, Golgi apparatus, Golgi stack |
Customer validation | WB (Mus musculus, Homo sapiens) ICC (Homo sapiens) IF (Homo sapiens) IHC (Homo sapiens) Co-IP (Mus musculus) |
Submit your question about A7527 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on ZFYVE1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to ZFYVE1. (Distance between topics and target gene indicate popularity.) ZFYVE1
* Data provided by citexs.com, for reference only.
Publishing research using A7527? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.