Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZFYVE1 Rabbit pAb (A7527)

Publications (6) Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - ZFYVE1 Rabbit pAb (A7527)

Western blot analysis of extracts of 293T cells, using ZFYVE1 antibody (A7527) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name ZFYVE1 Rabbit pAb
Catalog No. A7527
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate-containing membranes. This protein contains two zinc-binding FYVE domains in tandem and is reported to localize to the Golgi apparatus. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 500-735 of human ZFYVE1 (NP_067083.1).
Sequence AKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIVHVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILHCHNCRKEFSIKLSKH
Gene ID 53349
Swiss prot Q9HBF4
Synonyms SR3; DFCP1; TAFF1; ZNFN2A1; PPP1R172; ZFYVE1
Calculated MW 87kDa
Observed MW 87kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T
Cellular location Endoplasmic reticulum, Golgi apparatus, Golgi stack
Customer validation

WB (Mus musculus, Homo sapiens)

ICC (Homo sapiens)

IF (Homo sapiens)

IHC (Homo sapiens)

Co-IP (Mus musculus)

ZFYVE1 Rabbit pAb images

ABclonal:Western blot - ZFYVE1 Rabbit pAb (A7527)}

Western blot - ZFYVE1 Rabbit pAb (A7527)

Western blot analysis of extracts of 293T cells, using ZFYVE1 antibody (A7527) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A7527 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZFYVE1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZFYVE1. (Distance between topics and target gene indicate popularity.) ZFYVE1

* Data provided by citexs.com, for reference only.

Publishing research using A7527? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order