Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ZEB1 Rabbit mAb (A21794)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of HeLa cells, using ZEB1 antibody (A21794) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of extracts of Mouse heart, using ZEB1 antibody (A21794) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s.

You may also interested in:

Overview

Product name	ZEB1 Rabbit mAb
Catalog No.	A21794
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53599

Background

This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 800-900 of human ZEB1 (NP_110378.3).
Sequence	INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
Gene ID	6935
Swiss prot	P37275
Synonyms	BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1
Calculated MW	124kDa
Observed MW	200KDa

Applications

Reactivity	Human, Mouse
Tested applications	Testing results
WB	HumanMouse
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting
Positive samples	HeLa, Mouse heart
Cellular location	Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ZEB1 Rabbit mAb images

Western blot - ZEB1 Rabbit mAb (A21794)

Product Protocols

Inquire About This Product

Submit your question about A21794 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZEB1. (Numbers indicate number of published articles where both targets appear.)

◀1/▶

Related Research Area

Based on existing publications, the following research topics are related to ZEB1. (Distance between topics and target gene indicate popularity.) ZEB1

* Data provided by citexs.com, for reference only.