Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ZEB1 Rabbit mAb (A21794)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - ZEB1 Rabbit mAb (A21794)

Western blot analysis of extracts of HeLa cells, using ZEB1 antibody (A21794) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name ZEB1 Rabbit mAb
Catalog No. A21794
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC53599

Background

This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human ZEB1 (NP_110378.3).
Sequence INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
Gene ID 6935
Swiss prot P37275
Synonyms BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1; ZEB1
Calculated MW 124kDa
Observed MW 200kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, Mouse heart
Cellular location Nucleus
Customer validation

WB (Homo sapiens )

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ZEB1 Rabbit mAb images

ABclonal:Western blot - ZEB1 Rabbit mAb (A21794)}

Western blot - ZEB1 Rabbit mAb (A21794)

Western blot analysis of extracts of HeLa cells, using ZEB1 antibody (A21794) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A21794 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZEB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZEB1. (Distance between topics and target gene indicate popularity.) ZEB1

* Data provided by citexs.com, for reference only.

Publishing research using A21794? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order