Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZCCHC10 Rabbit pAb (A16539)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - ZCCHC10 Rabbit pAb (A16539)

Western blot analysis of lysates from Mouse eye, using ZCCHC10 Rabbit pAb (A16539) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name ZCCHC10 Rabbit pAb
Catalog No. A16539
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable nucleic acid binding activity and zinc ion binding activity.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ZCCHC10 (NP_001287745.1).
Sequence MATPMHRLIARRQAFDTELQPVKTFWILIQPSIVISEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVERKA
Gene ID 54819
Swiss prot Q8TBK6
Synonyms ZCCHC10
Calculated MW 21kDa
Observed MW 21kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse eye
Cellular location

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ZCCHC10 Rabbit pAb images

ABclonal:Western blot - ZCCHC10 Rabbit pAb (A16539)}

Western blot - ZCCHC10 Rabbit pAb (A16539)

Western blot analysis of lysates from Mouse eye, using ZCCHC10 Rabbit pAb (A16539) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A16539 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZCCHC10. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZCCHC10. (Distance between topics and target gene indicate popularity.) ZCCHC10

* Data provided by citexs.com, for reference only.

Publishing research using A16539? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order