Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

YY1AP1 Rabbit pAb (A13104)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - YY1AP1 Rabbit pAb (A13104)

Western blot analysis of various lysates using YY1AP1 Rabbit pAb (A13104) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name YY1AP1 Rabbit pAb
Catalog No. A13104
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable transcription coregulator activity. Involved in cell differentiation; cell population proliferation; and regulation of cell cycle. Located in fibrillar center and nucleoplasm. Colocalizes with Ino80 complex.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human YY1AP1 (NP_060723.2).
Sequence MGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQT
Gene ID 55249
Swiss prot Q9H869
Synonyms GRNG; HCCA1; HCCA2; YY1AP; YY1AP1
Calculated MW 88kDa
Observed MW 88kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HT-29, BxPC-3, SGC-7901, HepG2, Mouse liver, Rat lung
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

YY1AP1 Rabbit pAb images

ABclonal:Western blot - YY1AP1 Rabbit pAb (A13104)}

Western blot - YY1AP1 Rabbit pAb (A13104)

Western blot analysis of various lysates using YY1AP1 Rabbit pAb (A13104) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A13104 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on YY1AP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to YY1AP1. (Distance between topics and target gene indicate popularity.) YY1AP1

* Data provided by citexs.com, for reference only.

Publishing research using A13104? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order