Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] YAP1 Rabbit mAb (A19134)

KO/KDValidated

Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] YAP1 Rabbit mAb (A19134)

Western blot analysis of lysates from C6 cells, using [KO Validated] YAP1 Rabbit mAb (A19134) at1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] YAP1 Rabbit mAb (A19134)

Western blot analysis of lysates from Mouse heart, using [KO Validated] YAP1 Rabbit mAb (A19134) at1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Western blot - [KO Validated] YAP1 Rabbit mAb (A19134)

Western blot analysis of lysates from wild type(WT) and YAP1 knockout (KO) HeLa cells, using [KO Validated] YAP1 Rabbit mAb (A19134) at1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded human colon carcinoma tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded Human lung adenocarcinoma tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded human spleen tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded mouse spleen tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded rat colon tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded rat spleen tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] YAP1 Rabbit mAb (A19134) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunofluorescence analysis of U20S cells using [KO Validated] YAP1 Rabbit mAb (A19134) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunofluorescence analysis of HeLa cells using [KO Validated] YAP1 Rabbit mAb (A19134) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunoprecipitation analysis of 300 μg extracts of A-549 cells using 3 μg YAP1 antibody (A19134). Western blot was performed from the immunoprecipitate using YAP1 antibody (A19134) at a dilution of 1:500.

You may also interested in:

Overview

Product name [KO Validated] YAP1 Rabbit mAb
Catalog No. A19134
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC53477

Background

This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
Sequence PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Gene ID 10413
Swiss prot P46937
Synonyms YAP; YKI; COB1; YAP2; YAP-1; YAP65; P1
Calculated MW 36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa
Observed MW 72kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouse
WB HumanMouseRat
IHC-P Human
Recommended dilution
  • WB 1:2000 - 1:4000
  • IHC-P 1:100 - 1:500
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, Mouse heart, C6
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

IF (Mus musculus)

IHC (Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] YAP1 Rabbit mAb images

ABclonal:Western blot - [KO Validated] YAP1 Rabbit mAb (A19134)}

Western blot - [KO Validated] YAP1 Rabbit mAb (A19134)

Western blot analysis of lysates from C6 cells, using [KO Validated] YAP1 Rabbit mAb (A19134) at1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] YAP1 Rabbit mAb (A19134)}

Western blot - [KO Validated] YAP1 Rabbit mAb (A19134)

Western blot analysis of lysates from Mouse heart, using [KO Validated] YAP1 Rabbit mAb (A19134) at1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
ABclonal:Western blot - [KO Validated] YAP1 Rabbit mAb (A19134)}

Western blot - [KO Validated] YAP1 Rabbit mAb (A19134)

Western blot analysis of lysates from wild type(WT) and YAP1 knockout (KO) HeLa cells, using [KO Validated] YAP1 Rabbit mAb (A19134) at1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)}

Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded human colon carcinoma tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)}

Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded Human lung adenocarcinoma tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)}

Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded human spleen tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)}

Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded mouse spleen tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)}

Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded rat colon tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)}

Immunohistochemistry - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunohistochemistry analysis of YAP1 in paraffin-embedded rat spleen tissue using [KO Validated] YAP1 Rabbit mAb (A19134) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - [KO Validated] YAP1 Rabbit mAb (A19134)}

Immunofluorescence - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] YAP1 Rabbit mAb (A19134) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] YAP1 Rabbit mAb (A19134)}

Immunofluorescence - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunofluorescence analysis of U20S cells using [KO Validated] YAP1 Rabbit mAb (A19134) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] YAP1 Rabbit mAb (A19134)}

Immunofluorescence - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunofluorescence analysis of HeLa cells using [KO Validated] YAP1 Rabbit mAb (A19134) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - [KO Validated] YAP1 Rabbit mAb (A19134)}

Immunoprecipitation - [KO Validated] YAP1 Rabbit mAb (A19134)

Immunoprecipitation analysis of 300 μg extracts of A-549 cells using 3 μg YAP1 antibody (A19134). Western blot was performed from the immunoprecipitate using YAP1 antibody (A19134) at a dilution of 1:500.

Inquire About This Product

Submit your question about A19134 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on YAP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to YAP1. (Distance between topics and target gene indicate popularity.) YAP1

* Data provided by citexs.com, for reference only.

Publishing research using A19134? Please let us know so that we can cite the reference in this datasheet.

Antibodies (13)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order