Publications (6) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | [KO Validated] YAP1 Rabbit mAb |
---|---|
Catalog No. | A19134 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC53477 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
---|---|
Sequence | PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL |
Gene ID | 10413 |
Swiss prot | P46937 |
Synonyms | YAP; YKI; COB1; YAP2; YAP-1; YAP65; P1 |
Calculated MW | 36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa |
Observed MW | 72kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
IF/ICC | |
WB | |
IHC-P | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, Mouse heart, C6 |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB (Homo sapiens, Mus musculus, Rattus norvegicus) IF (Mus musculus) IHC (Homo sapiens, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A19134 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on YAP1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to YAP1. (Distance between topics and target gene indicate popularity.) YAP1
* Data provided by citexs.com, for reference only.
Publishing research using A19134? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.