Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

XRCC2 Rabbit pAb (A1800)

Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - XRCC2 Rabbit pAb (A1800)

Western blot analysis of extracts of various cell lines, using XRCC2 antibody (A1800) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - XRCC2 Rabbit pAb (A1800)

Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using XRCC2 Rabbit pAb (A1800) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - XRCC2 Rabbit pAb (A1800)

Immunohistochemistry analysis of paraffin-embedded rat lung using XRCC2 Rabbit pAb (A1800) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name XRCC2 Rabbit pAb
Catalog No. A1800
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human XRCC2 (NP_005422.1).
Sequence MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDT
Gene ID 7516
Swiss prot O43543
Synonyms FANCU; POF17; SPGF50; XRCC2
Calculated MW 32kDa
Observed MW 32kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples K-562, Mouse liver, Mouse heart, Rat testis, Rat brain
Cellular location Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center
Customer validation

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

XRCC2 Rabbit pAb images

ABclonal:Western blot - XRCC2 Rabbit pAb (A1800)}

Western blot - XRCC2 Rabbit pAb (A1800)

Western blot analysis of extracts of various cell lines, using XRCC2 antibody (A1800) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - XRCC2 Rabbit pAb (A1800)}

Immunohistochemistry - XRCC2 Rabbit pAb (A1800)

Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using XRCC2 Rabbit pAb (A1800) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - XRCC2 Rabbit pAb (A1800)}

Immunohistochemistry - XRCC2 Rabbit pAb (A1800)

Immunohistochemistry analysis of paraffin-embedded rat lung using XRCC2 Rabbit pAb (A1800) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1800 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on XRCC2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to XRCC2. (Distance between topics and target gene indicate popularity.) XRCC2

* Data provided by citexs.com, for reference only.

Publishing research using A1800? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order