Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

WNT5A Rabbit mAb (A19133)

Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - WNT5A Rabbit mAb (A19133)

Western blot analysis of extracts of various cell lines, using WNT5A antibody (A19133) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - WNT5A Rabbit mAb (A19133)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using WNT5A Rabbit mAb (A19133) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name WNT5A Rabbit mAb
Catalog No. A19133
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0405

Background

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 281-380 of human WNT5A (P41221).
Sequence RGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
Gene ID 7474
Swiss prot P41221
Synonyms hWNT5A; WNT5A
Calculated MW 42kDa
Observed MW 42kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
IHC-P Human
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, SK-OV-3
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

WB (Mus musculus, Homo sapiens, Drosophila melanogaster, Oryctolagus cuniculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

WNT5A Rabbit mAb images

ABclonal:Western blot - WNT5A Rabbit mAb (A19133)}

Western blot - WNT5A Rabbit mAb (A19133)

Western blot analysis of extracts of various cell lines, using WNT5A antibody (A19133) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - WNT5A Rabbit mAb (A19133)}

Immunohistochemistry - WNT5A Rabbit mAb (A19133)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using WNT5A Rabbit mAb (A19133) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19133 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on WNT5A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to WNT5A. (Distance between topics and target gene indicate popularity.) WNT5A

* Data provided by citexs.com, for reference only.

Publishing research using A19133? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order