Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

WNT2B Rabbit mAb (A19554)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - WNT2B Rabbit mAb (A19554)

Western blot analysis of extracts of various cell lines, using WNT2B Rabbit mAb (A19554) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name WNT2B Rabbit mAb
Catalog No. A19554
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2172

Background

This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as carcinogenesis. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human WNT2B (Q93097).
Sequence KAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
Gene ID 7482
Swiss prot Q93097
Synonyms WNT13; WNT2B
Calculated MW 44kDa
Observed MW 50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, PC-3, U-87MG, Mouse lung, Mouse testis, Mouse brain, Rat testis, Rat uterus
Cellular location extracellular region, extracellular space

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

WNT2B Rabbit mAb images

ABclonal:Western blot - WNT2B Rabbit mAb (A19554)}

Western blot - WNT2B Rabbit mAb (A19554)

Western blot analysis of extracts of various cell lines, using WNT2B Rabbit mAb (A19554) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A19554 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on WNT2B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to WNT2B. (Distance between topics and target gene indicate popularity.) WNT2B

* Data provided by citexs.com, for reference only.

Publishing research using A19554? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order