Publications (14) Datasheet SDS COA
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition
Reactivity:Human, Mouse, Rat
Product name | Vinculin Rabbit mAb |
---|---|
Catalog No. | A2752 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51900 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1). |
---|---|
Sequence | DAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM |
Gene ID | 7414 |
Swiss prot | P18206 |
Synonyms | MV; MVCL; CMD1W; CMH15; HEL114 |
Calculated MW | 124kDa |
Observed MW | 124kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
IF/ICC | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, HepG2, RD, Mouse liver, Mouse brain, Rat liver, Rat skeletal muscle, Rat brain |
Cellular location | Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, adherens junction, cytoskeleton, focal adhesion |
Customer validation | WB(Homo sapiens, Oryctolagus cuniculus, Anatinae, Mus musculus, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A2752 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on VCL. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to VCL. (Distance between topics and target gene indicate popularity.) VCL
* Data provided by citexs.com, for reference only.
Publishing research using A2752? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.