Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Vinculin Rabbit mAb (A2752)

Tested applications:WB IHC IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Vinculin Rabbit mAb (A2752) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - Vinculin Rabbit mAb (A2752)

Confocal imaging of HeLa cells using Vinculin Rabbit mAb (A2752, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

ABclonal:Immunoprecipitation - Vinculin Rabbit mAb (A2752)

Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Vinculin antibody (A2752). Western blot was performed from the immunoprecipitate using Vinculin antibody (A2752) at a dilution of 1:1000.

Overview

Product name	Vinculin Rabbit mAb
Catalog No.	A2752
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51900

Background

Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1).
Sequence	DAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
Gene ID	7414
Swiss prot	P18206
Synonyms	CMD1W; CMH15; HEL114; MV; MVCL
Calculated MW	125kDa
Observed MW	124kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting Immunoprecipitation
Positive samples	HeLa, HepG2, RD, Mouse liver, Mouse brain, Rat liver, Rat skeletal muscle, Rat brain
Cellular location	Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, adherens junction, cytoskeleton, focal adhesion
Customer validation	WB(Homo sapiens, Oryctolagus cuniculus, Anatinae)