Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

VPS11 Rabbit mAb (A19798)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - VPS11 Rabbit mAb (A19798)

Western blot analysis of extracts of various cell lines, using VPS11 Rabbit mAb (A19798) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Western blot - VPS11 Rabbit mAb (A19798)

Western blot analysis of extracts of various cell lines, using VPS11 Rabbit mAb (A19798) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - VPS11 Rabbit mAb (A19798)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using VPS11 Rabbit mAb (A19798) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - VPS11 Rabbit mAb (A19798)

Immunohistochemistry analysis of paraffin-embedded mouse stomach using VPS11 Rabbit mAb (A19798) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name VPS11 Rabbit mAb
Catalog No. A19798
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2325

Background

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps11 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VPS11 (Q9H270).
Sequence MAAYLQWRRFVFFDKELVKEPLSNDGAAPGATPASGSAASKFLCLPPGITVCDSGRGSLVFGDMEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILA
Gene ID 55823
Swiss prot Q9H270
Synonyms END1; PEP5; HLD12; RNF108; hVPS11; DYT32; VPS11
Calculated MW 108kDa
Observed MW 108kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
IHC-P HumanMouse
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, A-431, Raji, Mouse testis, Mouse brain
Cellular location autophagosome, clathrin-coated vesicle, CORVET complex, early endosome, endosome, late endosome, lysosome

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

VPS11 Rabbit mAb images

ABclonal:Western blot - VPS11 Rabbit mAb (A19798)}

Western blot - VPS11 Rabbit mAb (A19798)

Western blot analysis of extracts of various cell lines, using VPS11 Rabbit mAb (A19798) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Western blot - VPS11 Rabbit mAb (A19798)}

Western blot - VPS11 Rabbit mAb (A19798)

Western blot analysis of extracts of various cell lines, using VPS11 Rabbit mAb (A19798) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - VPS11 Rabbit mAb (A19798)}

Immunohistochemistry - VPS11 Rabbit mAb (A19798)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using VPS11 Rabbit mAb (A19798) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - VPS11 Rabbit mAb (A19798)}

Immunohistochemistry - VPS11 Rabbit mAb (A19798)

Immunohistochemistry analysis of paraffin-embedded mouse stomach using VPS11 Rabbit mAb (A19798) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19798 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on VPS11. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to VPS11. (Distance between topics and target gene indicate popularity.) VPS11

* Data provided by citexs.com, for reference only.

Publishing research using A19798? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order