Reviews (3) Publications (15) Datasheet SDS
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | VEGF Receptor 2 Rabbit pAb |
---|---|
Catalog No. | A5609 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1150-1250 of human VEGF Receptor 2 (NP_002244.1). |
---|---|
Sequence | RPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVK |
Gene ID | 3791 |
Swiss prot | P35968 |
Synonyms | FLK1; CD309; VEGFR; VEGFR2; VEGF Receptor 2 |
Calculated MW | 152kDa |
Observed MW | 210kDa/230kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | Mouse heart |
Cellular location | Cell junction, Cell membrane, Cytoplasm, Cytoplasmic vesicle, Early endosome, Endoplasmic reticulum, Nucleus, Secreted, Single-pass type I membrane protein |
Customer validation | IHC (Eoma cell) WB (Eoma cell, HUVEC cells, Homo sapiens, Mus musculus, Rattus norvegicus) IF (Mus musculus, Gallus gallus) WB (Gallus gallus) WB,IF (Gallus gallus) WB,IHC,IF (Homo sapiens) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A5609 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on KDR. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to KDR. (Distance between topics and target gene indicate popularity.) KDR
* Data provided by citexs.com, for reference only.
Publishing research using A5609? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.