Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

VEGFA Rabbit pAb (A0280)

Publications (16) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - VEGFA Rabbit pAb (A0280)

Western blot analysis of various lysates, using VEGFA Rabbit pAb (A0280) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunohistochemistry - VEGFA Rabbit pAb (A0280)

Immunohistochemistry analysis of VEGFA in paraffin-embedded human lung cancer using VEGFA Rabbit pAb (A0280) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - VEGFA Rabbit pAb (A0280)

Immunofluorescence analysis of NIH/3T3 cells using VEGFA Rabbit pAb (A0280) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name VEGFA Rabbit pAb
Catalog No. A0280
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome. Allelic variants of this gene have been associated with microvascular complications of diabetes 1 (MVCD1) and atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been described. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. The levels of VEGF are increased during infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), thus promoting inflammation by facilitating recruitment of inflammatory cells, and by increasing the level of angiopoietin II (Ang II), one of two products of the SARS-CoV-2 binding target, angiotensin-converting enzyme 2 (ACE2). In turn, Ang II facilitates the elevation of VEGF, thus forming a vicious cycle in the release of inflammatory cytokines.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human VEGFA (NP_001165094.1).
Sequence SNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQ
Gene ID 7422
Swiss prot P15692
Synonyms VPF; VEGF; MVCD1; VEGFA
Calculated MW 27kDa
Observed MW 16kDa/34kDa/40kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples U-87MG, K-562, Mouse heart, Rat heart
Cellular location Secreted
Customer validation

WB (Mus musculus, Oryctolagus cuniculus, Homo sapiens, Rattus norvegicus)

IHC (Homo sapiens, Rattus norvegicus)

IF (Mus musculus, Homo sapiens)

ICC (Homo sapiens)

IHC-P (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

VEGFA Rabbit pAb images

ABclonal:Western blot - VEGFA Rabbit pAb (A0280)}

Western blot - VEGFA Rabbit pAb (A0280)

Western blot analysis of various lysates, using VEGFA Rabbit pAb (A0280) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
ABclonal:Immunohistochemistry - VEGFA Rabbit pAb (A0280)}

Immunohistochemistry - VEGFA Rabbit pAb (A0280)

Immunohistochemistry analysis of VEGFA in paraffin-embedded human lung cancer using VEGFA Rabbit pAb (A0280) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - VEGFA Rabbit pAb (A0280)}

Immunofluorescence - VEGFA Rabbit pAb (A0280)

Immunofluorescence analysis of NIH/3T3 cells using VEGFA Rabbit pAb (A0280) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0280 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on VEGFA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to VEGFA. (Distance between topics and target gene indicate popularity.) VEGFA

* Data provided by citexs.com, for reference only.

Publishing research using A0280? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Proteins (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order