Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

USO1 Rabbit mAb (A20950)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - USO1 Rabbit mAb (A20950)

Western blot analysis of various lysates using USO1 Rabbit mAb (A20950) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded mouse kidney tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded Human lung adenocarcinoma tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded rat kidney tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded mouse testis tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded mouse brain tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded human colon carcinoma tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - USO1 Rabbit mAb (A20950)

Confocal imaging of HeLa cells using USO1 Rabbit mAb (A20950, dilution 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:200) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

You may also interested in:

Overview

Product name USO1 Rabbit mAb
Catalog No. A20950
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2937

Background

The protein encoded by this gene is a peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase. It is regulated by phosphorylation: dephosphorylated protein associates with the Golgi membrane and dissociates from the membrane upon phosphorylation. Ras-associated protein 1 recruits this protein to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where it interacts with a set of COPII vesicle-associated SNAREs to form a cis-SNARE complex that promotes targeting to the Golgi apparatus. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USO1 (O60763).
Sequence MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQAMEHLIHVLQTDRSDSEIIGYALDTLYNIISNEEEEEVEE
Gene ID 8615
Swiss prot O60763
Synonyms TAP; VDP; P115; USO1
Calculated MW 108kDa
Observed MW 115kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouse
IHC-P HumanMouseRat
WB HumanMouseRat
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HepG2, 293T, K-562, MCF7, Mouse thymus, Rat liver
Cellular location Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

USO1 Rabbit mAb images

ABclonal:Western blot - USO1 Rabbit mAb (A20950)}

Western blot - USO1 Rabbit mAb (A20950)

Western blot analysis of various lysates using USO1 Rabbit mAb (A20950) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)}

Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded mouse kidney tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)}

Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded Human lung adenocarcinoma tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)}

Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded rat kidney tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)}

Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded mouse testis tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)}

Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded mouse brain tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - USO1 Rabbit mAb (A20950)}

Immunohistochemistry - USO1 Rabbit mAb (A20950)

Immunohistochemistry analysis of USO1 in paraffin-embedded human colon carcinoma tissue using USO1 Rabbit mAb (A20950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - USO1 Rabbit mAb (A20950)}

Immunofluorescence - USO1 Rabbit mAb (A20950)

Confocal imaging of HeLa cells using USO1 Rabbit mAb (A20950, dilution 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:200) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Inquire About This Product

Submit your question about A20950 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on USO1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to USO1. (Distance between topics and target gene indicate popularity.) USO1

* Data provided by citexs.com, for reference only.

Publishing research using A20950? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order