Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

USO1 Rabbit pAb (A16079)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - USO1 Rabbit pAb (A16079)

Western blot analysis of various lysates using USO1 Rabbit pAb (A16079) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - USO1 Rabbit pAb (A16079)

Immunofluorescence analysis of HeLa cells using USO1 Rabbit pAb (A16079) at dilution of 1:200 (60x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - USO1 Rabbit pAb (A16079)

Confocal immunofluorescence analysis of Hela cells using USO1 Rabbit pAb (A16079) at dilution of 1:200. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - USO1 Rabbit pAb (A16079)

Confocal immunofluorescence analysis of HeLa cells using USO1 Rabbit pAb (A16079) at dilution of 1:50. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name USO1 Rabbit pAb
Catalog No. A16079
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase. It is regulated by phosphorylation: dephosphorylated protein associates with the Golgi membrane and dissociates from the membrane upon phosphorylation. Ras-associated protein 1 recruits this protein to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where it interacts with a set of COPII vesicle-associated SNAREs to form a cis-SNARE complex that promotes targeting to the Golgi apparatus. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 663-962 of human USO1 (NP_003706.2).
Sequence DLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI
Gene ID 8615
Swiss prot O60763
Synonyms TAP; VDP; P115; USO1
Calculated MW 108kDa
Observed MW 108kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples U-87MG, Raji, SGC7901
Cellular location Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

USO1 Rabbit pAb images

ABclonal:Western blot - USO1 Rabbit pAb (A16079)}

Western blot - USO1 Rabbit pAb (A16079)

Western blot analysis of various lysates using USO1 Rabbit pAb (A16079) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - USO1 Rabbit pAb (A16079)}

Immunofluorescence - USO1 Rabbit pAb (A16079)

Immunofluorescence analysis of HeLa cells using USO1 Rabbit pAb (A16079) at dilution of 1:200 (60x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - USO1 Rabbit pAb (A16079)}

Immunofluorescence - USO1 Rabbit pAb (A16079)

Confocal immunofluorescence analysis of Hela cells using USO1 Rabbit pAb (A16079) at dilution of 1:200. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - USO1 Rabbit pAb (A16079)}

Immunofluorescence - USO1 Rabbit pAb (A16079)

Confocal immunofluorescence analysis of HeLa cells using USO1 Rabbit pAb (A16079) at dilution of 1:50. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16079 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on USO1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to USO1. (Distance between topics and target gene indicate popularity.) USO1

* Data provided by citexs.com, for reference only.

Publishing research using A16079? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order