Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ULK1 Rabbit pAb (A8529)

Publications (19) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ULK1 Rabbit pAb (A8529)

Western blot analysis of lysates from Rat brain, using ULK1 Rabbit pAb (A8529) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Western blot - ULK1 Rabbit pAb (A8529)

Western blot analysis of various lysates, using ULK1 Rabbit pAb (A8529) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - ULK1 Rabbit pAb (A8529)

Immunofluorescence analysis of HeLa cells using ULK1 Rabbit pAb (A8529) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - ULK1 Rabbit pAb (A8529)

Immunofluorescence analysis of NIH/3T3 cells using ULK1 Rabbit pAb (A8529) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ULK1 Rabbit pAb
Catalog No. A8529
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables identical protein binding activity; protein serine/threonine kinase activity; and small GTPase binding activity. Involved in several processes, including autophagosome assembly; positive regulation by symbiont of host autophagy; and protein phosphorylation. Located in autophagosome; cytosol; and phagophore assembly site membrane. Is extrinsic component of autophagosome membrane; extrinsic component of omegasome membrane; and extrinsic component of phagophore assembly site membrane. Part of Atg1/ULK1 kinase complex.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ULK1 (NP_003556.1).
Sequence SSCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQS
Gene ID 8408
Swiss prot O75385
Synonyms ATG1; ATG1A; UNC51; hATG1; Unc51.1; ULK1
Calculated MW 113kDa
Observed MW 150kDa/140kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T, HepG2, Rat brain, Mouse thymus, Rat testis
Cellular location Cytoplasm, Preautophagosomal structure, cytosol
Customer validation

WB (Homo sapiens, Mus musculus, Spodoptera frugiperda, Sus scrofa, Fathead minnow, Horabagrus nigricollaris)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ULK1 Rabbit pAb images

ABclonal:Western blot - ULK1 Rabbit pAb (A8529)}

Western blot - ULK1 Rabbit pAb (A8529)

Western blot analysis of lysates from Rat brain, using ULK1 Rabbit pAb (A8529) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Western blot - ULK1 Rabbit pAb (A8529)}

Western blot - ULK1 Rabbit pAb (A8529)

Western blot analysis of various lysates, using ULK1 Rabbit pAb (A8529) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - ULK1 Rabbit pAb (A8529)}

Immunofluorescence - ULK1 Rabbit pAb (A8529)

Immunofluorescence analysis of HeLa cells using ULK1 Rabbit pAb (A8529) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - ULK1 Rabbit pAb (A8529)}

Immunofluorescence - ULK1 Rabbit pAb (A8529)

Immunofluorescence analysis of NIH/3T3 cells using ULK1 Rabbit pAb (A8529) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A8529 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ULK1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ULK1. (Distance between topics and target gene indicate popularity.) ULK1

* Data provided by citexs.com, for reference only.

Publishing research using A8529? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order