Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

UGGT1 Rabbit pAb (A4866)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - UGGT1 Rabbit pAb (A4866)

Western blot analysis of extracts of various cell lines, using UGGT1 antibody (A4866) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name UGGT1 Rabbit pAb
Catalog No. A4866
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1456-1555 of human UGGT1 (NP_064505.1).
Sequence PNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL
Gene ID 56886
Swiss prot Q9NYU2
Synonyms UGT1; HUGT1; UGCGL1; UGGT1
Calculated MW 177kDa
Observed MW 177kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SH-SY5Y, 293T, HepG2, HL-60, HT-1080, Mouse liver, Mouse kidney, Rat liver, Rat brain
Cellular location Endoplasmic reticulum lumen, Endoplasmic reticulum-Golgi intermediate compartment

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

UGGT1 Rabbit pAb images

ABclonal:Western blot - UGGT1 Rabbit pAb (A4866)}

Western blot - UGGT1 Rabbit pAb (A4866)

Western blot analysis of extracts of various cell lines, using UGGT1 antibody (A4866) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A4866 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on UGGT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to UGGT1. (Distance between topics and target gene indicate popularity.) UGGT1

* Data provided by citexs.com, for reference only.

Publishing research using A4866? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order