Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

UBE2C Rabbit pAb (A5499)

Review (1) Publications (7) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - UBE2C Rabbit pAb (A5499)

Western blot analysis of various lysates, using UBE2C Rabbit pAb (A5499) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - UBE2C Rabbit pAb (A5499)

Immunohistochemistry analysis of UBE2C in paraffin-embedded mouse testis using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - UBE2C Rabbit pAb (A5499)

Immunohistochemistry analysis of UBE2C in paraffin-embedded rat testis using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - UBE2C Rabbit pAb (A5499)

Immunofluorescence analysis of HeLa cells using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - UBE2C Rabbit pAb (A5499)

Immunofluorescence analysis of MCF7 cells using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - UBE2C Rabbit pAb (A5499)

Immunofluorescence analysis of NIH/3T3 cells using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - UBE2C Rabbit pAb (A5499)

Immunofluorescence analysis of PC-12 cells using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - UBE2C Rabbit pAb (A5499)

Immunoprecipitation analysis of 300 μg extracts of NIH/3T3 cells using 3 μg UBE2C antibody (A5499). Western blot was performed from the immunoprecipitate using UBE2C antibody (A5499) at a dilution of 1:1000.

Review
ABclonal: review for UBE2C Rabbit pAb(A5499)

You may also interested in:

Overview

Product name UBE2C Rabbit pAb
Catalog No. A5499
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human UBE2C (NP_008950.1).
Sequence MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Gene ID 11065
Swiss prot O00762
Synonyms UBCH10; dJ447F3.2; UBE2C
Calculated MW 20kDa
Observed MW 21kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples PC-3, NIH/3T3
Cellular location cytosol, nucleoplasm, nucleus, plasma membrane
Customer validation

WB (Human gastric cancer cellsHomo sapiens, Homo sapiens, Mus musculus)

IHC (Homo sapiens, Mus musculus)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

UBE2C Rabbit pAb images

ABclonal:Western blot - UBE2C Rabbit pAb (A5499)}

Western blot - UBE2C Rabbit pAb (A5499)

Western blot analysis of various lysates, using UBE2C Rabbit pAb (A5499) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunohistochemistry - UBE2C Rabbit pAb (A5499)}

Immunohistochemistry - UBE2C Rabbit pAb (A5499)

Immunohistochemistry analysis of UBE2C in paraffin-embedded mouse testis using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - UBE2C Rabbit pAb (A5499)}

Immunohistochemistry - UBE2C Rabbit pAb (A5499)

Immunohistochemistry analysis of UBE2C in paraffin-embedded rat testis using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - UBE2C Rabbit pAb (A5499)}

Immunofluorescence - UBE2C Rabbit pAb (A5499)

Immunofluorescence analysis of HeLa cells using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - UBE2C Rabbit pAb (A5499)}

Immunofluorescence - UBE2C Rabbit pAb (A5499)

Immunofluorescence analysis of MCF7 cells using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - UBE2C Rabbit pAb (A5499)}

Immunofluorescence - UBE2C Rabbit pAb (A5499)

Immunofluorescence analysis of NIH/3T3 cells using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - UBE2C Rabbit pAb (A5499)}

Immunofluorescence - UBE2C Rabbit pAb (A5499)

Immunofluorescence analysis of PC-12 cells using UBE2C Rabbit pAb (A5499) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - UBE2C Rabbit pAb (A5499)}

Immunoprecipitation - UBE2C Rabbit pAb (A5499)

Immunoprecipitation analysis of 300 μg extracts of NIH/3T3 cells using 3 μg UBE2C antibody (A5499). Western blot was performed from the immunoprecipitate using UBE2C antibody (A5499) at a dilution of 1:1000.

Submit an review for A5499

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5499 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on UBE2C. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to UBE2C. (Distance between topics and target gene indicate popularity.) UBE2C

* Data provided by citexs.com, for reference only.

Publishing research using A5499? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order