Review (1) Publications (7) Datasheet COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | UBE2C Rabbit pAb |
---|---|
Catalog No. | A5499 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human UBE2C (NP_008950.1). |
---|---|
Sequence | MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
Gene ID | 11065 |
Swiss prot | O00762 |
Synonyms | UBCH10; dJ447F3.2; UBE2C |
Calculated MW | 20kDa |
Observed MW | 21kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | PC-3, NIH/3T3 |
Cellular location | cytosol, nucleoplasm, nucleus, plasma membrane |
Customer validation | WB (Human gastric cancer cellsHomo sapiens, Homo sapiens, Mus musculus) IHC (Homo sapiens, Mus musculus) IP (Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A5499 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on UBE2C. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to UBE2C. (Distance between topics and target gene indicate popularity.) UBE2C
* Data provided by citexs.com, for reference only.
Publishing research using A5499? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.