Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

UBE2B Rabbit mAb (A0503)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - UBE2B Rabbit mAb (A0503)

Western blot analysis of extracts of Rat testis, using UBE2B antibody (A0503) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - UBE2B Rabbit mAb (A0503)

Western blot analysis of extracts of various cell lines, using UBE2B antibody (A0503) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded human cervix cancer tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded human colon carcinoma tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded mouse colon tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded mouse spleen tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded mouse testis tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded rat brain tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

You may also interested in:

Overview

Product name UBE2B Rabbit mAb
Catalog No. A0503
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2512

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 53-152 of human UBE2B (P63146).
Sequence FKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS
Gene ID 7320
Swiss prot P63146
Synonyms HR6B; UBC2; HHR6B; RAD6B; E2-17kDa; UBE2B
Calculated MW 17kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanMouseRat
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, 293T, NIH/3T3, K-562, Mouse testis, Mouse heart, Rat testis
Cellular location Cell membrane, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

UBE2B Rabbit mAb images

ABclonal:Western blot - UBE2B Rabbit mAb (A0503)}

Western blot - UBE2B Rabbit mAb (A0503)

Western blot analysis of extracts of Rat testis, using UBE2B antibody (A0503) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - UBE2B Rabbit mAb (A0503)}

Western blot - UBE2B Rabbit mAb (A0503)

Western blot analysis of extracts of various cell lines, using UBE2B antibody (A0503) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)}

Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded human cervix cancer tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)}

Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded human colon carcinoma tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)}

Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded mouse colon tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)}

Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded mouse spleen tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)}

Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded mouse testis tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - UBE2B Rabbit mAb (A0503)}

Immunohistochemistry - UBE2B Rabbit mAb (A0503)

Immunohistochemistry analysis of UBE2B in paraffin-embedded rat brain tissue using UBE2B Rabbit mAb (A0503) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Inquire About This Product

Submit your question about A0503 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on UBE2B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to UBE2B. (Distance between topics and target gene indicate popularity.) UBE2B

* Data provided by citexs.com, for reference only.

Publishing research using A0503? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order