Product Type > Antibodies > Tag and Loading Control Antibodies

β-Tubulin Rabbit pAb (AC015)

Publications (30) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - β-Tubulin Rabbit pAb (AC015)

Western blot analysis of various lysates using β-Tubulin Rabbit pAb (AC015) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Western blot - β-Tubulin Rabbit pAb (AC015)

Western blot analysis of various lysates, using β-Tubulin Rabbit pAb (AC015) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)

Immunohistochemistry analysis of β-Tubulin in paraffin-embedded rat brain tissue using β-Tubulin Rabbit pAb (AC015) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)

Immunohistochemistry analysis of β-Tubulin in paraffin-embedded mouse testis tissue using β-Tubulin Rabbit pAb (AC015) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)

Immunohistochemistry analysis of β-Tubulin in paraffin-embedded human colon tissue using β-Tubulin Rabbit pAb (AC015) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)

Immunohistochemistry analysis of β-Tubulin in paraffin-embedded human liver tissue using β-Tubulin Rabbit pAb (AC015) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)

Immunohistochemistry analysis of β-Tubulin in paraffin-embedded human cervix cancer tissue using β-Tubulin Rabbit pAb (AC015) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - β-Tubulin Rabbit pAb (AC015)

Immunofluorescence analysis of A431 cells using β-Tubulin Rabbit pAb (AC015) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - β-Tubulin Rabbit pAb (AC015)

Immunofluorescence analysis of HeLa cells using β-Tubulin Rabbit pAb (AC015) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name β-Tubulin Rabbit pAb
Catalog No. AC015
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human β-Tubulin (NP_006077.2).
Sequence SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF
Gene ID 203068
Swiss prot P07437
Synonyms M40; TUBB1; TUBB5; CDCBM6; CSCSC1; OK/SW-cl.56; β-Tubulin
Calculated MW 50kDa
Observed MW 50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SH-SY5Y, HeLa, A-549, MCF7, HepG2, Mouse eye, Rat spinal cord
Cellular location Cytoplasm, cytoskeleton
Customer validation

WB (Mus musculus, Rattus norvegicus, Homo sapiens, Bos taurus, oyster Crassostrea gigas, Sus scrofa)

IP (Homo sapiens)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

β-Tubulin Rabbit pAb images

ABclonal:Western blot - β-Tubulin Rabbit pAb (AC015)}

Western blot - β-Tubulin Rabbit pAb (AC015)

Western blot analysis of various lysates using β-Tubulin Rabbit pAb (AC015) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Western blot - β-Tubulin Rabbit pAb (AC015)}

Western blot - β-Tubulin Rabbit pAb (AC015)

Western blot analysis of various lysates, using β-Tubulin Rabbit pAb (AC015) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)}

Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)

Immunohistochemistry analysis of β-Tubulin in paraffin-embedded rat brain tissue using β-Tubulin Rabbit pAb (AC015) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)}

Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)

Immunohistochemistry analysis of β-Tubulin in paraffin-embedded mouse testis tissue using β-Tubulin Rabbit pAb (AC015) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)}

Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)

Immunohistochemistry analysis of β-Tubulin in paraffin-embedded human colon tissue using β-Tubulin Rabbit pAb (AC015) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)}

Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)

Immunohistochemistry analysis of β-Tubulin in paraffin-embedded human liver tissue using β-Tubulin Rabbit pAb (AC015) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)}

Immunohistochemistry - β-Tubulin Rabbit pAb (AC015)

Immunohistochemistry analysis of β-Tubulin in paraffin-embedded human cervix cancer tissue using β-Tubulin Rabbit pAb (AC015) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - β-Tubulin Rabbit pAb (AC015)}

Immunofluorescence - β-Tubulin Rabbit pAb (AC015)

Immunofluorescence analysis of A431 cells using β-Tubulin Rabbit pAb (AC015) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - β-Tubulin Rabbit pAb (AC015)}

Immunofluorescence - β-Tubulin Rabbit pAb (AC015)

Immunofluorescence analysis of HeLa cells using β-Tubulin Rabbit pAb (AC015) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about AC015 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TUBB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TUBB. (Distance between topics and target gene indicate popularity.) TUBB

* Data provided by citexs.com, for reference only.

Publishing research using AC015? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order