Product Type > Antibodies > Tag and Loading Control Antibodies

α-Tubulin Rabbit pAb (AC007)

Publications (37) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - α-Tubulin Rabbit pAb (AC007)

Western blot analysis of various lysates using α-Tubulin Rabbit pAb (AC007) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - α-Tubulin Rabbit pAb (AC007)

Western blot analysis of various lysates, using α-Tubulin Rabbit pAb (AC007) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - α-Tubulin Rabbit pAb (AC007)

Confocal immunofluorescence analysis of U2OS cells using α-Tubulin Rabbit pAb (AC007) at dilution of 1:100 (60x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - α-Tubulin Rabbit pAb (AC007)

Immunofluorescence analysis of U2OS cells using α-Tubulin Rabbit pAb (AC007) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name α-Tubulin Rabbit pAb
Catalog No. AC007
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene encodes an alpha tubulin that is a highly conserved homolog of a rat testis-specific alpha tubulin. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human α-Tubulin (NP_005991.1).
Sequence MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
Gene ID 7277
Swiss prot P68366
Synonyms ALS22; TUBA1; H2-ALPHA; α-Tubulin
Calculated MW 50kDa
Observed MW 55kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples A-431, HeLa, K-562, Mouse kidney, Mouse brain
Cellular location Cytoplasm, cytoskeleton
Customer validation

WB (Mus musculus, Brachyura, Sus scrofa, Homo sapiens, Xenopus laevis, Rana amurensis Boulenger, Rattus norvegicus, Capra hircus, Cabbage beetles)

Co-IP (Homo sapiens, Rattus norvegicus)

IP (Homo sapiens)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

α-Tubulin Rabbit pAb images

ABclonal:Western blot - α-Tubulin Rabbit pAb (AC007)}

Western blot - α-Tubulin Rabbit pAb (AC007)

Western blot analysis of various lysates using α-Tubulin Rabbit pAb (AC007) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - α-Tubulin Rabbit pAb (AC007)}

Western blot - α-Tubulin Rabbit pAb (AC007)

Western blot analysis of various lysates, using α-Tubulin Rabbit pAb (AC007) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - α-Tubulin Rabbit pAb (AC007)}

Immunofluorescence - α-Tubulin Rabbit pAb (AC007)

Confocal immunofluorescence analysis of U2OS cells using α-Tubulin Rabbit pAb (AC007) at dilution of 1:100 (60x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - α-Tubulin Rabbit pAb (AC007)}

Immunofluorescence - α-Tubulin Rabbit pAb (AC007)

Immunofluorescence analysis of U2OS cells using α-Tubulin Rabbit pAb (AC007) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about AC007 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TUBA4A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TUBA4A. (Distance between topics and target gene indicate popularity.) TUBA4A

* Data provided by citexs.com, for reference only.

Publishing research using AC007? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order