Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Troponin I2 (TNNI2) Rabbit pAb (A7937)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - Troponin I2 (TNNI2) Rabbit pAb (A7937)

Western blot analysis of extracts of various cell lines, using Troponin I2 (Troponin I2 (TNNI2)) antibody (A7937) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name Troponin I2 (TNNI2) Rabbit pAb
Catalog No. A7937
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Troponin I2 (Troponin I2 (TNNI2)) (NP_003273.1).
Sequence MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
Gene ID 7136
Swiss prot P48788
Synonyms DA2B; FSSV; DA2B1; fsTnI; AMCD2B; Troponin I2 (TNNI2)
Calculated MW 21kDa
Observed MW 21kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse skeletal muscle, Rat skeletal muscle
Cellular location cytosol, nucleus
Customer validation

WB (Sus scrofa, Ovis aries)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Troponin I2 (TNNI2) Rabbit pAb images

ABclonal:Western blot - Troponin I2 (TNNI2) Rabbit pAb (A7937)}

Western blot - Troponin I2 (TNNI2) Rabbit pAb (A7937)

Western blot analysis of extracts of various cell lines, using Troponin I2 (Troponin I2 (TNNI2)) antibody (A7937) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A7937 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TNNI2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TNNI2. (Distance between topics and target gene indicate popularity.) TNNI2

* Data provided by citexs.com, for reference only.

Publishing research using A7937? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order