Product Type > Antibodies > Primary Antibodies > Methyl-specific Antibodies

TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Reviews (3) Publications (13) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:Western blot - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Western blot analysis of various lysates, using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Dot Blot - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Dot-blot analysis of all sorts of methylation peptides using TriMethyl-Histone H3-K36 antibody (A2366).

ABclonal:Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Immunohistochemistry analysis of TriMethyl-Histone H3-K36 in paraffin-embedded human lung using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Immunohistochemistry analysis of TriMethyl-Histone H3-K36 in paraffin-embedded human spleen using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Immunohistochemistry analysis of TriMethyl-Histone H3-K36 in paraffin-embedded mouse lung using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Immunohistochemistry analysis of TriMethyl-Histone H3-K36 in paraffin-embedded rat lung using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Immunofluorescence analysis of 293T cells using TriMethyl-Histone H3-K36 Rabbit pAb (A2366). Blue: DAPI for nuclear staining.

ABclonal:Chromatin Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Chromatin immunoprecipitation analysis of extracts of HeLa; cells, using TriMethyl-Histone H3-K36 Rabbit pAb antibody (A2366) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

ABclonal:Chromatin Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K36 antibody (A2366) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

ABclonal:Chromatin Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Chromatin immunoprecipitation analysis of extracts of Hale cells, using TriMethyl-Histone H3-K36 antibody (A2366) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Review
ABclonal: review for TriMethyl-Histone H3-K36 Rabbit pAb(A2366)
Review
ABclonal: review for TriMethyl-Histone H3-K36 Rabbit pAb(A2366)
Review
ABclonal: review for TriMethyl-Histone H3-K36 Rabbit pAb(A2366)

You may also interested in:

Overview

Product name TriMethyl-Histone H3-K36 Rabbit pAb
Catalog No. A2366
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1).
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID 82908350
Swiss prot Q16695P68431
Synonyms H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K36
Calculated MW 16kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • DB 1:500 - 1:2000
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • ChIP 5μg antibody for 5μg-10μg of Chromatin
  • ChIP-seq 1:20 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples MCF7, C2C12, PC-12
Cellular location Chromosome, Nucleus
Customer validation

IF (HEK293THomo sapiens, Mus musculus, Rattus norvegicus)

WB (HEK293T, HippocampusHomo sapiens, Yeast, Mus musculus, Homo sapiens, Oryza sativa, Saccharomyces cerevisiae, Eurosta solidaginis, Rattus norvegicus)

IHC (Sus scrofa, Rattus norvegicus)

ChIP (Oryza sativa)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

TriMethyl-Histone H3-K36 Rabbit pAb images

ABclonal:Western blot - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)}

Western blot - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Western blot analysis of various lysates, using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Dot Blot - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)}

Dot Blot - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Dot-blot analysis of all sorts of methylation peptides using TriMethyl-Histone H3-K36 antibody (A2366).
ABclonal:Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)}

Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Immunohistochemistry analysis of TriMethyl-Histone H3-K36 in paraffin-embedded human lung using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)}

Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Immunohistochemistry analysis of TriMethyl-Histone H3-K36 in paraffin-embedded human spleen using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)}

Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Immunohistochemistry analysis of TriMethyl-Histone H3-K36 in paraffin-embedded mouse lung using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)}

Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Immunohistochemistry analysis of TriMethyl-Histone H3-K36 in paraffin-embedded rat lung using TriMethyl-Histone H3-K36 Rabbit pAb (A2366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)}

Immunofluorescence - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Immunofluorescence analysis of 293T cells using TriMethyl-Histone H3-K36 Rabbit pAb (A2366). Blue: DAPI for nuclear staining.
ABclonal:Chromatin Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)}

Chromatin Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Chromatin immunoprecipitation analysis of extracts of HeLa; cells, using TriMethyl-Histone H3-K36 Rabbit pAb antibody (A2366) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
ABclonal:Chromatin Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)}

Chromatin Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K36 antibody (A2366) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
ABclonal:Chromatin Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)}

Chromatin Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit pAb (A2366)

Chromatin immunoprecipitation analysis of extracts of Hale cells, using TriMethyl-Histone H3-K36 antibody (A2366) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Submit an review for A2366

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2366 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on H3-4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to H3-4. (Distance between topics and target gene indicate popularity.) H3-4

* Data provided by citexs.com, for reference only.

Publishing research using A2366? Please let us know so that we can cite the reference in this datasheet.

Antibodies (114)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order