Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Tau Rabbit mAb (A23490)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Tau Rabbit mAb (A23490)

Western blot analysis of various lysates, using Tau Rabbit mAb (A23490) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - Tau Rabbit mAb (A23490)

Confocal imaging of human brain using Tau Rabbit mAb (A23490, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Confocal imaging of mouse brain using Tau Rabbit mAb (A23490, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

ABclonal:Immunoprecipitation - Tau Rabbit mAb (A23490)

Immunoprecipitation analysis of 300 μg extracts from SH-SY5Y cells using 3 μg Tau antibody (A23490). Western blot was performed from the immunoprecipitate using Tau antibody (A23490) at a dilution of 1:1000.

You may also interested in:

Overview

Product name	Tau Rabbit mAb
Catalog No.	A23490
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC58125

Background

This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAPT (NM_005910.6)
Sequence	MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG
Gene ID	4137
Swiss prot	P10636
Synonyms	TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; tau-40; FTDP-17; PPP1R103; Tau-PHF6
Calculated MW	79kDa
Observed MW	50-80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	SH-SY5Y, U-251MG, Mouse brain, Rat brain
Cellular location	Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, axon, Cytoskeleton, Cytosol

Research Area

Tau Rabbit mAb images

Western blot - Tau Rabbit mAb (A23490)

Immunofluorescence - Tau Rabbit mAb (A23490)

Immunoprecipitation - Tau Rabbit mAb (A23490)

Product Protocols

Inquire About This Product

Submit your question about A23490 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAPT. (Numbers indicate number of published articles where both targets appear.)

◀1/▶

Related Research Area

Based on existing publications, the following research topics are related to MAPT. (Distance between topics and target gene indicate popularity.) MAPT

* Data provided by citexs.com, for reference only.