Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition
Reactivity:Human, Mouse, Rat
Product name | Tau Rabbit mAb |
---|---|
Catalog No. | A23490 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC58125 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAPT (NM_005910.6) |
---|---|
Sequence | MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG |
Gene ID | 4137 |
Swiss prot | P10636 |
Synonyms | TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; tau-40; FTDP-17; PPP1R103; Tau-PHF6 |
Calculated MW | 79kDa |
Observed MW | 50-80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | SH-SY5Y, U-251MG, Mouse brain, Rat brain |
Cellular location | Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, axon, Cytoskeleton, Cytosol |
Submit your question about A23490 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on MAPT. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to MAPT. (Distance between topics and target gene indicate popularity.) MAPT
* Data provided by citexs.com, for reference only.
Publishing research using A23490? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.