Publications (26) Datasheet SDS
Tested applications:WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | α-Tubulin Rabbit pAb |
---|---|
Catalog No. | AC007 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human α-Tubulin (NP_005991.1). |
---|---|
Sequence | MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA |
Gene ID | 7277 |
Swiss prot | P68366 |
Synonyms | TUBA4A; ALS22; H2-ALPHA; TUBA1 |
Calculated MW | 48kDa/49kDa |
Observed MW | 55kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. May contain BSA. If BSA-free batch required, please contact us. |
Application key | Western blotting |
Positive samples | A-431, HeLa, K-562, Mouse kidney, Mouse brain |
Cellular location | Cytoplasm, cytoskeleton |
Customer validation | WB(Mus musculus, Brachyura, Sus scrofa, Homo sapiens, Rattus norvegicus, Xenopus laevis, Rana amurensis Boulenger) Co-IP(Homo sapiens) IP(Homo sapiens) |
Submit your question about AC007 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on TUBA4A. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to TUBA4A. (Distance between topics and target gene indicate popularity.) TUBA4A
* Data provided by citexs.com, for reference only.
Publishing research using AC007? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.