Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TPP2 Rabbit pAb (A6421)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TPP2 Rabbit pAb (A6421)

Western blot analysis of extracts of various cell lines, using TPP2 antibody (A6421) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - TPP2 Rabbit pAb (A6421)

Immunofluorescence analysis of U2OS cells using TPP2 antibody (A6421). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name TPP2 Rabbit pAb
Catalog No. A6421
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a mammalian peptidase that, at neutral pH, removes tripeptides from the N terminus of longer peptides. The protein has a specialized function that is essential for some MHC class I antigen presentation. The protein is a high molecular mass serine exopeptidase; the amino acid sequence surrounding the serine residue at the active site is similar to the peptidases of the subtilisin class rather than the trypsin class.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human TPP2 (NP_003282.2).
Sequence MATAATEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTR
Gene ID 7174
Swiss prot P29144
Synonyms IMD78; TPP-2; TPPII; TPP-II; TPP2
Calculated MW 138kDa
Observed MW 138kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Jurkat, SW620, HeLa, HepG2, Mouse brain, Mouse spleen
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

TPP2 Rabbit pAb images

ABclonal:Western blot - TPP2 Rabbit pAb (A6421)}

Western blot - TPP2 Rabbit pAb (A6421)

Western blot analysis of extracts of various cell lines, using TPP2 antibody (A6421) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - TPP2 Rabbit pAb (A6421)}

Immunofluorescence - TPP2 Rabbit pAb (A6421)

Immunofluorescence analysis of U2OS cells using TPP2 antibody (A6421). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A6421 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TPP2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TPP2. (Distance between topics and target gene indicate popularity.) TPP2

* Data provided by citexs.com, for reference only.

Publishing research using A6421? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order