Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TNRC6A Rabbit pAb (A6115)

Tested applications:WB IHC IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using TNRC6A antibody (A6115) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - TNRC6A Rabbit pAb (A6115)

Immunofluorescence analysis of U2OS cells using TNRC6A antibody (A6115) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	TNRC6A Rabbit pAb
Catalog No.	A6115
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the trinucleotide repeat containing 6 protein family. The protein functions in post-transcriptional gene silencing through the RNA interference (RNAi) and microRNA pathways. The protein associates with messenger RNAs and Argonaute proteins in cytoplasmic bodies known as GW-bodies or P-bodies. Inhibiting expression of this gene delocalizes other GW-body proteins and impairs RNAi and microRNA-induced gene silencing.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 950-1050 of human TNRC6A (NP_055309.2).
Sequence	QDIVGSWGIPPATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAIS
Gene ID	27327
Swiss prot	Q8NDV7
Synonyms	TNRC6A; CAGH26; GW1; GW182; TNRC6
Calculated MW	17kDa/36kDa/182kDa/205kDa/206kDa/210kDa
Observed MW	180kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. May contain BSA. If BSA-free batch required, please contact us.
Application key	Western blotting
Positive samples	Mouse brain, Rat brain
Cellular location	Cytoplasm, P-body
Customer validation	WB(Homo sapiens)

TNRC6A Rabbit pAb images

Western blot - TNRC6A Rabbit pAb (A6115)

Immunofluorescence - TNRC6A Rabbit pAb (A6115)

Immunofluorescence analysis of U2OS cells using TNRC6A antibody (A6115) at dilution of 1:100. Blue: DAPI for nuclear staining.

Product Protocols

Inquire About This Product

Submit your question about A6115 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TNRC6A. (Numbers indicate number of published articles where both targets appear.)

◀1/▶

Related Research Area

Based on existing publications, the following research topics are related to TNRC6A. (Distance between topics and target gene indicate popularity.) TNRC6A

* Data provided by citexs.com, for reference only.