Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TNRC6A Rabbit pAb (A6115)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TNRC6A Rabbit pAb (A6115)

Western blot analysis of extracts of various cell lines, using TNRC6A antibody (A6115) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - TNRC6A Rabbit pAb (A6115)

Immunofluorescence analysis of U2OS cells using TNRC6A antibody (A6115) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name TNRC6A Rabbit pAb
Catalog No. A6115
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the trinucleotide repeat containing 6 protein family. The protein functions in post-transcriptional gene silencing through the RNA interference (RNAi) and microRNA pathways. The protein associates with messenger RNAs and Argonaute proteins in cytoplasmic bodies known as GW-bodies or P-bodies. Inhibiting expression of this gene delocalizes other GW-body proteins and impairs RNAi and microRNA-induced gene silencing.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 950-1050 of human TNRC6A (NP_055309.2).
Sequence QDIVGSWGIPPATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAIS
Gene ID 27327
Swiss prot Q8NDV7
Synonyms GW1; FAME6; GW182; TNRC6; CAGH26; TNRC6A
Calculated MW 210kDa
Observed MW 180kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse brain, Rat brain
Cellular location Cytoplasm, P-body
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

TNRC6A Rabbit pAb images

ABclonal:Western blot - TNRC6A Rabbit pAb (A6115)}

Western blot - TNRC6A Rabbit pAb (A6115)

Western blot analysis of extracts of various cell lines, using TNRC6A antibody (A6115) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - TNRC6A Rabbit pAb (A6115)}

Immunofluorescence - TNRC6A Rabbit pAb (A6115)

Immunofluorescence analysis of U2OS cells using TNRC6A antibody (A6115) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A6115 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TNRC6A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TNRC6A. (Distance between topics and target gene indicate popularity.) TNRC6A

* Data provided by citexs.com, for reference only.

Publishing research using A6115? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order