Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TNNC1 Rabbit pAb (A1927)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - TNNC1 Rabbit pAb (A1927)

Western blot analysis of various lysates, using TNNC1 Rabbit pAb (A1927) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - TNNC1 Rabbit pAb (A1927)

Immunofluorescence analysis of rat heart cells using TNNC1 Rabbit pAb (A1927) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name TNNC1 Rabbit pAb
Catalog No. A1927
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TNNC1 (NP_003271.1).
Sequence MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV
Gene ID 7134
Swiss prot P63316
Synonyms TNC; TN-C; TNNC; CMD1Z; CMH13; TNNC1
Calculated MW 18kDa
Observed MW 18kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse heart, Rat heart
Cellular location cytosol
Customer validation

WB (Homo sapiens, Ovis aries, Mus musculus)

IHC (Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TNNC1 Rabbit pAb images

ABclonal:Western blot - TNNC1 Rabbit pAb (A1927)}

Western blot - TNNC1 Rabbit pAb (A1927)

Western blot analysis of various lysates, using TNNC1 Rabbit pAb (A1927) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - TNNC1 Rabbit pAb (A1927)}

Immunofluorescence - TNNC1 Rabbit pAb (A1927)

Immunofluorescence analysis of rat heart cells using TNNC1 Rabbit pAb (A1927) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1927 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TNNC1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TNNC1. (Distance between topics and target gene indicate popularity.) TNNC1

* Data provided by citexs.com, for reference only.

Publishing research using A1927? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order