Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TNFSF14/LIGHT Rabbit pAb (A2002)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TNFSF14/LIGHT Rabbit pAb (A2002)

Western blot analysis of various lysates, using TNFSF14/LIGHT antibody (A2002) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name TNFSF14/LIGHT Rabbit pAb
Catalog No. A2002
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 59-176 of human TNFSF14/LIGHT (NP_003798.2).
Sequence LQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEE
Gene ID 8740
Swiss prot O43557
Synonyms LTg; CD258; HVEML; LIGHT; TNFSF14/LIGHT
Calculated MW 26kDa
Observed MW 28kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse thymus, Rat spleen
Cellular location Cell membrane, Cytoplasm, Secreted, Single-pass type II membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TNFSF14/LIGHT Rabbit pAb images

ABclonal:Western blot - TNFSF14/LIGHT Rabbit pAb (A2002)}

Western blot - TNFSF14/LIGHT Rabbit pAb (A2002)

Western blot analysis of various lysates, using TNFSF14/LIGHT antibody (A2002) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A2002 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TNFSF14. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TNFSF14. (Distance between topics and target gene indicate popularity.) TNFSF14

* Data provided by citexs.com, for reference only.

Publishing research using A2002? Please let us know so that we can cite the reference in this datasheet.

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order