Review (1)Publications (15) Datasheet
Western blot analysis of extracts of various cell lines, using TNF-α antibody (A0277) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry of paraffin-embedded Human colon carcinoma using TNF-α antibody (A0277) at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded Human breast cancer using TNF-α antibody (A0277) at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded Human gastric cancer using TNF-α antibody (A0277) at dilution of 1:100 (40x lens).
Immunofluorescence analysis of Human mammary cancer cells using TNF-α antibody (A0277) at dilution of 1:100. Blue: DAPI for nuclear staining.
| Product name | TNF-α Rabbit pAb |
|---|---|
| Catalog No. | A0277 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-233 of human TNF (NP_000585.2). |
|---|---|
| Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Gene ID | 7124 |
| Swiss prot | P01375 |
| Synonyms | TNF; DIF; TNF-alpha; TNFA; TNFSF2; TNLG1F; TNF alpha |
| Calculated MW | 25kDa |
| Observed MW | 17KDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
| Recommended dilution | WB 1:1000 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 |
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application key | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | THP-1, RAW264.7 |
| Cellular location | Cell membrane, Membrane, Secreted, Single-pass type II membrane protein, Single-pass type II membrane protein |
| Customer validation | (Mouse embryonal fibroblast cell) WB(Rattus norvegicus, Homo sapiens, Mus musculus, Canis lupus familiaris, Sus scrofa) ELISA(Mus musculus) WB(Mus musculus) IHC(Mus musculus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A0277 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A0277? Please let us know so that we can cite the reference in this datasheet.
