Review (1)Publications (20) Datasheet
Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | TNF-α Rabbit pAb |
---|---|
Catalog No. | A0277 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNF (NP_000585.2). |
---|---|
Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEG |
Gene ID | 7124 |
Swiss prot | P01375 |
Synonyms | TNF; DIF; TNF-alpha; TNFA; TNFSF2; TNLG1F; TNF alpha |
Calculated MW | 25kDa |
Observed MW | 26KDa/28KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | U-937, RAW264.7, Mouse thymus, Rat thymus |
Cellular location | Cell membrane, Membrane, Secreted, Single-pass type II membrane protein, Single-pass type II membrane protein |
Customer validation | (Mouse embryonal fibroblast cell) WB(Rattus norvegicus, Homo sapiens, Canis lupus familiaris, Mus musculus, Sus scrofa) ELISA(Mus musculus) WB(Mus musculus) IHC(Mus musculus) IHC(Rattus norvegicus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A0277 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A0277? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.