Product name | TNFR1 Rabbit pAb |
---|---|
Catalog No. | A1540 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-211 of human TNFR1 (NP_001056.1). |
---|---|
Sequence | IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT |
Gene ID | 7132 |
Swiss prot | P19438 |
Synonyms | TNFRSF1A; CD120a; FPF; TBP1; TNF-R; TNF-R-I; TNF-R55; TNFAR; TNFR1; TNFR55; TNFR60; p55; p55-R; p60 |
Calculated MW | 24kDa/25kDa/38kDa/50kDa |
Observed MW | 55KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | A-549, Rat kidney |
Cellular location | Cell membrane, Golgi apparatus membrane, Secreted, Secreted, Single-pass type I membrane protein |
Customer validation | WB(Mus musculus) |
Submit your question about A1540 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A1540? Please let us know so that we can cite the reference in this datasheet.