Products > Catalog Antibodies > Polyclonal Antibodies

TNFR1/TNFRSF1A Rabbit pAb (A1540)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using TNFR1/TNFRSF1A antibody (A1540) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - TNFR1/TNFRSF1A Rabbit pAb (A1540)

Immunohistochemistry of paraffin-embedded rat lung using TNFR1/TNFRSF1A Rabbit pAb (A1540) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry of paraffin-embedded rat spleen using TNFR1/TNFRSF1A Rabbit pAb (A1540) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry of paraffin-embedded mouse spleen using TNFR1/TNFRSF1A Rabbit pAb (A1540) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - TNFR1/TNFRSF1A Rabbit pAb (A1540)

Immunofluorescence analysis of BALB-3T3 cells using TNFR1/TNFRSF1A Rabbit pAb (A1540) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	TNFR1/TNFRSF1A Rabbit pAb
Catalog No.	A1540
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the TNF receptor superfamily of proteins. The encoded receptor is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Binding of membrane-bound tumor necrosis factor alpha to the membrane-bound receptor induces receptor trimerization and activation, which plays a role in cell survival, apoptosis, and inflammation. Proteolytic processing of the encoded receptor results in release of the soluble form of the receptor, which can interact with free tumor necrosis factor alpha to inhibit inflammation. Mutations in this gene underlie tumor necrosis factor receptor-associated periodic syndrome (TRAPS), characterized by fever, abdominal pain and other features. Mutations in this gene may also be associated with multiple sclerosis in human patients.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 345-455 of human TNFR1/TNFRSF1A (NP_001056.1).
Sequence	AHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
Gene ID	7132
Swiss prot	P19438
Synonyms	TNFRSF1A; CD120a; FPF; TBP1; TNF-R; TNF-R-I; TNF-R55; TNFAR; TNFR1; TNFR55; TNFR60; p55; p55-R; p60
Calculated MW	24kDa/25kDa/38kDa/50kDa
Observed MW	55KDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A-549, C6
Cellular location	Cell membrane, Golgi apparatus membrane, Secreted, Secreted, Single-pass type I membrane protein
Customer validation	WB(Mus musculus, Homo sapiens, Marine Streptomyces sp)

Research Area

TNFR1/TNFRSF1A Rabbit pAb images

Western blot - TNFR1/TNFRSF1A Rabbit pAb (A1540)

Immunohistochemistry - TNFR1/TNFRSF1A Rabbit pAb (A1540)

Immunofluorescence - TNFR1/TNFRSF1A Rabbit pAb (A1540)

Immunofluorescence analysis of BALB-3T3 cells using TNFR1/TNFRSF1A Rabbit pAb (A1540) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.