Products > Catalog Antibodies > Monoclonal Antibodies

TNFAIP3 Rabbit mAb (A19128)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human

Western blot analysis of extracts of various cell lines, using TNFAIP3 antibody (A19128) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - TNFAIP3 Rabbit mAb (A19128)

Immunohistochemistry of paraffin-embedded human colon carcinoma using TNFAIP3 Rabbit mAb (A19128) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	TNFAIP3 Rabbit mAb
Catalog No.	A19128
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2012]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 450-550 of human TNFAIP3 (P21580).
Sequence	PEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSS
Gene ID	7128
Swiss prot	P21580
Synonyms	A20; AISBL; OTUD7C; TNFA1P2; TNFAIP3
Calculated MW	82kDa
Observed MW	82kDa

Applications

Reactivity	Human
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IHC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry
Positive samples	Jurkat, HeLa
Cellular location	Cytoplasm, Lysosome, Nucleus