Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TMPRSS2 Rabbit pAb (A1979)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TMPRSS2 Rabbit pAb (A1979)

Western blot analysis of various lysates using TMPRSS2 Rabbit pAb (A1979) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - TMPRSS2 Rabbit pAb (A1979)

Immunohistochemistry analysis of TMPRSS2 in paraffin-embedded human breast cancer using TMPRSS2 Rabbit pAb (A1979) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TMPRSS2 Rabbit pAb (A1979)

Immunohistochemistry analysis of TMPRSS2 in paraffin-embedded human esophageal cancer using TMPRSS2 Rabbit pAb (A1979) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - TMPRSS2 Rabbit pAb (A1979)

Immunofluorescence analysis of A-549 cells using TMPRSS2 Rabbit pAb (A1979) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - TMPRSS2 Rabbit pAb (A1979)

Immunofluorescence analysis of C6 cells using TMPRSS2 Rabbit pAb (A1979) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - TMPRSS2 Rabbit pAb (A1979)

Immunofluorescence analysis of NIH/3T3 cells using TMPRSS2 Rabbit pAb (A1979) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name TMPRSS2 Rabbit pAb
Catalog No. A1979
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. This protein also facilitates entry of viruses into host cells by proteolytically cleaving and activating viral envelope glycoproteins. Viruses found to use this protein for cell entry include Influenza virus and the human coronaviruses HCoV-229E, MERS-CoV, SARS-CoV and SARS-CoV-2 (COVID-19 virus). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TMPRSS2 (NP_005647.3).
Sequence MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAAL
Gene ID 7113
Swiss prot O15393
Synonyms PRSS10; TMPRSS2
Calculated MW 54kDa
Observed MW 70kDa/32kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse kidney, Mouse stomach, Rat large intestine, Rat lung, Rat kidney
Cellular location Cell membrane, Secreted, Single-pass type II membrane protein
Customer validation

WB (Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TMPRSS2 Rabbit pAb images

ABclonal:Western blot - TMPRSS2 Rabbit pAb (A1979)}

Western blot - TMPRSS2 Rabbit pAb (A1979)

Western blot analysis of various lysates using TMPRSS2 Rabbit pAb (A1979) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - TMPRSS2 Rabbit pAb (A1979)}

Immunohistochemistry - TMPRSS2 Rabbit pAb (A1979)

Immunohistochemistry analysis of TMPRSS2 in paraffin-embedded human breast cancer using TMPRSS2 Rabbit pAb (A1979) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TMPRSS2 Rabbit pAb (A1979)}

Immunohistochemistry - TMPRSS2 Rabbit pAb (A1979)

Immunohistochemistry analysis of TMPRSS2 in paraffin-embedded human esophageal cancer using TMPRSS2 Rabbit pAb (A1979) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - TMPRSS2 Rabbit pAb (A1979)}

Immunofluorescence - TMPRSS2 Rabbit pAb (A1979)

Immunofluorescence analysis of A-549 cells using TMPRSS2 Rabbit pAb (A1979) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - TMPRSS2 Rabbit pAb (A1979)}

Immunofluorescence - TMPRSS2 Rabbit pAb (A1979)

Immunofluorescence analysis of C6 cells using TMPRSS2 Rabbit pAb (A1979) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - TMPRSS2 Rabbit pAb (A1979)}

Immunofluorescence - TMPRSS2 Rabbit pAb (A1979)

Immunofluorescence analysis of NIH/3T3 cells using TMPRSS2 Rabbit pAb (A1979) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1979 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TMPRSS2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TMPRSS2. (Distance between topics and target gene indicate popularity.) TMPRSS2

* Data provided by citexs.com, for reference only.

Publishing research using A1979? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order