Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TKT Rabbit pAb (A6314)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TKT Rabbit pAb (A6314)

Western blot analysis of various lysates, using TKT Rabbit pAb (A6314) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - TKT Rabbit pAb (A6314)

Immunohistochemistry analysis of paraffin-embedded Rat liver using TKT antibody (A6314) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TKT Rabbit pAb (A6314)

Immunohistochemistry analysis of paraffin-embedded Human esophageal using TKT antibody (A6314) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name TKT Rabbit pAb
Catalog No. A6314
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a thiamine-dependent enzyme which plays a role in the channeling of excess sugar phosphates to glycolysis in the pentose phosphate pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human TKT (NP_001128527.1).
Sequence MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQS
Gene ID 7086
Swiss prot P29401
Synonyms TK; TKT1; SDDHD; HEL107; HEL-S-48; TKT
Calculated MW 68kDa
Observed MW 68kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples 293T, Hep G2, HeLa, Mouse kidney, Mouse thymus, Rat kidney
Cellular location cytosol, extracellular exosome, nuclear body, nucleoplasm, peroxisome

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TKT Rabbit pAb images

ABclonal:Western blot - TKT Rabbit pAb (A6314)}

Western blot - TKT Rabbit pAb (A6314)

Western blot analysis of various lysates, using TKT Rabbit pAb (A6314) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - TKT Rabbit pAb (A6314)}

Immunohistochemistry - TKT Rabbit pAb (A6314)

Immunohistochemistry analysis of paraffin-embedded Rat liver using TKT antibody (A6314) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TKT Rabbit pAb (A6314)}

Immunohistochemistry - TKT Rabbit pAb (A6314)

Immunohistochemistry analysis of paraffin-embedded Human esophageal using TKT antibody (A6314) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A6314 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TKT. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TKT. (Distance between topics and target gene indicate popularity.) TKT

* Data provided by citexs.com, for reference only.

Publishing research using A6314? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order